i } THE PONTIAC PRESS The Weather ; Home Rain ; i Details Page 2 Edition 113th YEAR x * * * PONTIAC, MICHIGAN, SATURDAY, DECEMBER i 1955 —38 PAGES | eee ATE TERRATIONAL WONITED PREss suoros 7 Prd » erry Christmas to All Our Reader The Coming of the King XIl-Back Home fo Galilee By NORMAN VINCENT PEALE Joseph and Mary made a home for their baby as best they could. They were refugees in a strange land, homesick for the land of Israel and their own village. But the baby was healthy and happy and they agreed they could ask no S$ Californians Flee Rampaging F lood © Yuba City Given Evacuation Edict * Twas the Night Before Christmas . vee ‘Traffic Accidents Claim Lives of 4 more. =— OY: A ° . ea tk ee sin County Areas as River Rises terrible crimes went 4 N WY | 3 States on West Coast on. He grew more blood-thirsty and ‘ killed his own son. At last, he become A) J Ferndale Resident Dies as Car Strikes Truck in Waterford Township | Report 22 Dead; 15,000 Square Miles Ruined swat billins totally insane \\ iy . died soon after- S jot =| Four persons died in| SAN FRANCISCO # —~ wards. a SL A =, F), 7 Oakland County holiday Authorities ordered the Just as Herod ae ln SG, ye 7 2S / traffic yesterday. evacuation of another cen- ‘aN hy VU be S19 ae we NAY died, Joseph, over\) in Egypt, had an- > other dream. An= tral California city early today as flood waters Dead are Kenneth Heide, (39, of Romeo; Bruce A. ' a angel again ap- Newman, 27, of Ferndale; |Surged over three states in peared to him and : Arthur Richards, 83, of | ‘one of the mightiest floods said: “Arise and = a= Royal Oak; and Louisiana | jin West Coast history. take the young The Light of the World Johnson, 45, of Detroit. | There are 17 known dead child and his mother, and go into the land of Israel: for they are dead which sought the young child’s life.” So, once again, Joseph and Mary prepared for a journey. They loaded their faithful donkey; Mary) mounted and took Jesus in her arms; and Joseph walked ahead leading the donkey. Back along the path of Moses they went into the Police said the accident land of Israel on their way to Bethlehem. But, on the) €/happened some time dur-_ way, they met someone who told them that Herod's | the night on d son was now the king in Jerusalem. And, warned again’ ng the night when Heide in a dream, Joseph took another road into Galilee and 4Pparently hit a tree. + back to their own village of Nazareth. | Newman's car, crossing into the Their house was still there and there was need of “Tg lane as it topped Waterford So Sorr y, F olks a good carpenter. It was easy to fall into their old ways Hill, ripped two wheels off a slow- No Snow Here Before Christms,”’ best-loved of all vee poems. Seated on tee | again. But now Jesus was one of the happy children ae ing semi-trailer coming up the who watched the carpenter at work. He learned to trust on student, wan for Christmas © Sada tae sare Bastia souk cs Babae™ Shes Parvs, ae dead on arrival at Pontiac Gun A drizzly Christmas is predicted ©- Standing intently in back are James, z. and Barbara Jo, 4. in God, honor Joseph and Mary, love His playmates and neighbors and follow the Commandments. He coal sy : oy olga Salpiened gl otepees Calvin D. Tottingham, 27, driver)S!onal rain and slightly colder tem- Hectic Start of Weekend = Crowds jane, plotters in California and five in Oregon. | Yuba City, a town of nearly 8,000 about 90 miles Heide'’s demolished car was found a quarter of a ‘mile from his home on Mc- Fadden and Keed roads this morning. Romeo State PEE a northeast of San Fran- cisco, was ordered evacu- ated shortly after mid- night when pounding wa- ters of the Feather River ‘smashed a 40-yard hole in ‘levees south of town. | led vicim: cusrion padce tae at ° Pontine Press Phote | AND ALL THROUGH THE HOUSE — A lighted window reveals a family scene which will be enacted in thousands of Pontiac area homes tonight as members of the households prepare to wait for | Santa Claus’ annual visit. Above, the James Porritt family, of a Mark S&t., gathers around a book to read and listen to ‘‘The N we y > Bridge Group Endorses Pike = =c'-s" worse oe as flood waters threatened to However, Legislator to |ture elaborate river defense et Introduce Bill to Delay To the south, an estimated | 3,000 persons ordered evac- Straits Toll Road = os east of San Francisco, probably wanted to be a carpenter. But the shepherds and the wise men from the East and even shee ‘Herod had known that he was born/|° the truck. told Sheriff's deputies|Pe ion! pam today's ee to be a king. And we know it today. That is why the|Newman’s car had hit his truck in Rain may turn to snow Monday the left side, tearing off the rear. ‘night, rpelting Tuesday with rising! s bi hildhood is the s of the story of his birth and c wal wheels of the tractor. ‘temperatures but returning Tues- coming of the King. ichard tri kill ‘day night or Wednesday, (Copyright 1955, the Hall Syndicate, Inc.) - nepal pal . pedestrian, was hen (Lowest Pontiac temperature pre: in dias A “ leeding 8 am. was 25 when a and sent ‘/noon when a train at a grade cross- roposed up parts of six streets covering PR GR EE So cident occurred, some 17 persons were jailed as Fea he tll turnpike trom ‘te the slough to free the water to Tangled Case Drags on jing on Center struck a © —_—— ‘Ohio border to the Strats of Mack: flew d by Edward R. Hansen, 70, drivers, and 16 others were hauled in by police on, into the Stockton ship chan. ue Xen ansem “ She Really Celebrates . . | mel. * uw — Ethel 104 Monday rivers and streams “that have brought destruction to what Army. engineers estimate at 10,000 to 15,- 000 square miles of land in Cali- fornia alone, " Southern Oregon, California's neighbor to the north, and Nevada, ‘across the Sierra Nevada range to the east, also battled flooding rivers. Philip D. Batson, regional Civil Defense administrator, estimated ‘early today that upwards of 20,000 persons had been evacuated from ‘homes in California, some 1,500 in |Oregon and more than 600 in Ne | vada, | * * | Damage estimates ran up to 10 [million dollars and likely will go ‘higher, Following the levee break at 'Yuba City, authorities said the ‘| rampaging Feather had dropped japproximately four inches and |cautiously predicted the crest had |passed, More than 1,500 men toiled ‘through the night at the sister |city of Marysville in a desperate ‘effort to bolster the Sagging levees. jwitn sandbags, ‘MRS, SUSAN KECK Reportedly Oakland. County's second oldest living resident, Mrs. Susan F, Keck of Lake Orion will celebrate her 104th birthday Mon- day. Now living in a convalescent home north of Pontiac, Mrs. Keck’ came from Missouri eight years/ ago to stay with a daughter in. Lake Orion newsmen, and state police by the squad car full during the series of evictions and near riots that have tward Ave. | Damage caused by Donald D. \Nolen, 17, of 642 Meadows St., has. yet been estimated, —| iPolice said. lot Huntington Woods. Hansen's car ie charges of drunk and disorderly conduct. Gilliland, F acing P rison, sircacheted ott three ee ae ao einett an vemnplove m the state’ Eight charged by Pontiac Police yesterday with drunk Chairman Prentiss M. Brown in Stockton's Civic Auditorhem ext Remai 1ns F ree on Appea Is Mrs. Johnson died as she was supreme court clerk's office, has driving and nine picked up on D and D charges are peoeddee! oe nee seat issued an emergency call for 500 eying hat iy gree Avemme = setae ° patent hay scheduled for arraignment in Municipal Court today. a formal resolution on the ae al cots and 1,000 blankets. | ova a The tangled legal history of Lapeer County farmers’ ee E. hecant. vA at Bicmadag: it's her birthday, her mother’s But prospects of SE s Day in Jail loomed for Genie S. ie set Meanwhile, rain fell over the evictions marked another milestone today in its 20-year ham, told police he didn’t see her birthday, and her parent's wedding others arrested, since many * | if janis y scheduled f0r drenched and beleaguered state ‘until the impact. ‘anniversary. justice courts, closed for “ . |for the ninth straight day, adding history, with no indication when the end will come. eestor ‘the holiday, will a Yugoslavs May Try ‘A Seth ole aye te the Straits,” more water to the already choked Two years ago today, Clayton C. ities was oon open until Tuesday. = casa aKuerinen’; astra See pictures and st immense value to t ory on “eee justice Tacy 0 Oo Press to Mark Holiday 8 In Pontiac, i police Middle East Dispute meee now under contractin, | *) —_ Twelve jurors debated! y) M d icars were smashed (sous une NATIONS NT. lt be another great eco. | ——————____— i 13 traffic acci en es- om —| coca = for the entire north |more than six hours and NO Paper Next 2 Mondays: ‘= poe ee 6 ; avia, comprom hoice for) ., Cer ae ences Delors Be Following its annual custom, The Pontiac Press | Warren E. Brown, 29, 667 Le|. UN. Security Council pry ‘It haw proved true time and quitting three farmers and : Baron Ave., rammed his car into. *\time again that whenever automo- finding Gilliland guilty. will omit publication Christmas. Se Monday - ithe rear of one police © car while) eo drafted as le East dis- ‘bile transportation facilities have “In another development in the) UNiversally observed as the holiday, The Press w Patrolman John W. Justice was pute now before ore 1 | been improved: in this area, traf. long battle, a Detroit Federal Dis|. "Ot appear that day. ticketing another driver for speed-'" Observers believe this was one|fie has likewise developed to make trict Court has dismissed a $250,000 Nor will The Press print a week hence. ing. Brown was — ariv-| or the reasons forthe council's: | full use of those facilities.”’ ‘[@amage suit brought by relatives Jan. 2 will generally be observed as the holiday, fre while under the influence of 7 Teported decision to hold up action READIES WRENCH seeking damages in the evection) nq this will be the first New Year’s in the memory ste on Syria's charges of aggression In Lansing, a Republican legisla-| and death of Lapeer County farm of the oldest inhabitant that The-Press has not The ‘second police car was against Israel until after Jan. 1,/tor said today he will file a bill widow Mrs, Elizabeth Stevens. struck when Robert L. Warring. when Yugoslavia takes her seat in the next session of the Legis- || mumee the failure of the fire in. | “PPeared. ton, 17, of 1225% Baldwin Ave. along with Cuba and Australia. The lature to block construction-of the! surance mutual in 1935, the White paper shortage is the reason. ran a stop sign at S. Parke and Council heard Syria's charges Saginaw-Flat Rock toll road for. courts have heard literally dot- re * * Cottage Sts. Warrington and Al- | Thursday, then - adjourne = SoS ens of cases on the matter. The St. Lawrence mill has just notified all mrt gcd ve 2 ee But all the action has not been its customers that shipments for 1956. will be om police of the peaceful variety seen in the reduced 13 per cent over 1955. In common with ee cee: United S pir it To uches All court room.. Violence bas called’- al] other newspapers in the country, the Press Two juveniles also in the car the attention of o a and na-| will use more newsprint in 1955 than its sources nae ere jo — i Ge We should remember that it was a Jew who to th i ing com-) . i" pea ere re “ ee Rag eel fee oe of supply were able to provide. ee (Gelieee this Gacradng. erctes The Lord is my shepherd, I shall not Back roads have seethed with “That means that, like et Gales ie etal | Another minor was jailed as want.” It was an Episcopalian who wrote O Little mean: gre a puties, “hurrying| ani this Masts hare, a) been ‘deahed. = ris Ri cars taroman, the fron 72wn Of Bethlehem. Martin Luther himself wrote itenants, m7 Ss, 5 ‘ : “a at x * * * plate glass window at 288 Wood- piri F press Is rape pone It was a Presby- Hence we will miss Monday purely as a pre- Seat Pep A Paks ock of Ages. A Catholic wrote cautionary measure. Some newspapers have al- nt Night. If we can share our hymns with one ready started omitting Saturday editions. The another, we should be able to do the same with Press hopes this will not be nents in Pontiac. other things —Bible Coin Unity. resulted (Continued on Page 2, Col. 4) ‘Ho, Ho, Ho! Here We Gol’ -- And Santa's on His Way : red'white penguins waddled across the tor Florida. Have you seen it any-|bridge. “But it does make sense,'then he heard a small voice cr. lady, who remains in & ,_(Bétors Note: “will Santa’ Claus'road in the sky. For his big . - le} plies al an of the time: is mont oxiou vgueaion i America te foaay. jsled was piled so high with gifts|snow in front of the reindeer. _|where?" you old softie.” ing: Hurricane Dust. Dust- Wind just as healthy as ever, authorities written for parents to read aloud to thetr it overflowed. It looked like a fly-| “Here, here, get out of the way,| “Climb abpard, climb aboard,”| Santa stood up to crack his whip| “Wait, please wait."’ in the home said. Sarees (lla = fevorite ig hayrack as it raced through) please,” said Santa Claus impor-|boomed Santa. “I'll drop you offjin the air—the signal to be off. But! It was Cluny, Santa’s favorite Whipping Colorado Monday she will enjoy a big in many homes.) the crisp cold air. . tantly. Then he said, surprised: _|there. But I must say this is the, |little elf. The other elves gossiped! birthday cake, as well as a Christ- By HAL BOYLE “Oh, dear, oh dear,” worried . : as tree, they added. NORTH POLE @—~He's off! (Santa, just before the takeoff. “I) “Why what. are you penguins first time I ever picked up three B ll ti about Cluny and said she was DENVER (—Dust-laden bared 5 Santa Claus is on his way at last! |do hope none of these presents fall a * at ‘the North rio bet \hitchhikers wearing tuexedoes.”’ u e In come at. snaking toys. bat & Santa ichiaan’ The old Saint and his/out and bean some poor innocent) W® ou're sappened Just then Mrs. Santa Claus came nts new it was only because she was Michigan $ Pay to Jobless pieneus i are zooming/rabbit orn | below, 1 believe this) the South Pole.” running out waving a long piece) NORTH POLE (INS) so young. He liked her because she Highest in U. S.—$33.70 |mnrough the arctic skies right now, sant the. henggon load I've| “We're on. a vacation,” ill laclas woe ad | —Snow was falling at the [bad a good heart, | ._ LANSING #—Michigan paid anjheading for the American border. ad Of the penguins, “We're looking) ¢You almost forgot your ist of | North Pole tonight, guar- | tere,” said the tiny elf, holding average $33.70 weekly benefit to/He'll reach it’ tonight. pale 4s he fretting about?” good children,” she said. anteeing good sledding for |up a small shiny figure. its unemployed this year. the high-| The northern lights switched on | Donder asked Vixen. “He's only |p Today’ : “Never mind,” said Santa, “T) gant Claus when he and | “What's this? What's this?”| est in the nationy the Michigan) t » clear steady green — the | riding in that sled We have to 11 oaays Press |,” dei". weed. Tite year 1 am going) “™™*® Cees when Re and | ied santé. “You're too Employers nga dr Com-| gq ahead” signal. Aid the | pull it.” ‘| Ballding News ........ 21 thru 27 |to give a present to every little, his reindeer take off |iate. My pack is already loaded.” penagtion Eugen reported Oday. pephine op —yrdiaremeael inary Vixen latighed so hard the bells} Church NéWs .......,..... 18.8 [boy and ir good or bad. The) headed for all the good “Tt is only my present to the ; | sent Santa ee . jon his harness tinkled in metry| County News ....... aveuns 16, 32 jbad ones will fee} sorry then, be- children in the world. The |“°"'4 ee oe it at 2 Dionries Quit Hospita "We are clearing all air lanes|music, And all the other reindeer! Editorials ..........ccscsc404.. 6 lcause they know they don’t. de- night in my room — all by my- MONTREAL @®-—The two ailingjin your path, old boy. There is laughed, too, Sports ....., berecsepeneees ins 2 carve & nice present. It'll make; temperature was comfort- | seit o members of the four salibtasiee cousd Dealt Sor yu sondage, Th As Santé Claus climbed up into, Theaters................ ore 14, 18 yem try harder to be good next) able (for the North Pole) ye the little figure from Dionne have ; { j . Go as the year,” . t a stead 15. degrees’ |D¢t hands.” It was a beautiful, ome. in. Call # ee pecThat isn’t cording to Hoyle,”) * fe angel with butterfly wings and a @ leaid rp. Cis who lites to play below zero. : (Continued on Page 2, Col. » ‘al Smid og ft ee : 4 c * @ i ee : ! ‘ 4 | Wie ‘ : ’ sts ;: a. ’ 4 “peter oo er ot 5 ett: “went off a road in Forrest Town- —\ Fl eects ¢ a Z 4 Pontiac Deaths Holiday Traffic Ponta Deaths on Rise ‘st nm sm Farrow, a native of Pontiac, died ‘6 Now Reported Killed suddenly yesterday morning in at A Center Hospital, Detfoit, when her) as Long Holiday Opens son, Patrick Henry, was born. Mrs. for Michigan [Farrow made her home at 2076 Hawthorne St., Farmington. By THE ASSOCIATED PRESS | She was born here Nov. 24, 1919) . Six persons died in, Michigan/and married in Pontiac Aug. 11 traffic accidents in the opening 1943. Her parents were Albert and pf the long Christmas weekend. | Agnes Swanson Larion. * Two others, died, however, in’ Mrs. Farrow, 36, attended Pon-) smashups that occurred just a few ! tiac Public Schools, and lived here | hours before the tabulation began until she moved to Farmington 4", at 6 p.m. Friday. The tabulation years ago. will end at midnight Monday. | a nurse, she hed been’ * Nineteen rsons were killed €™ployed at St. Joseph Mercy and, ta atte iting me amulsriesck: Pontiac General Hospitals. Her) ‘husband is a member of the Farm- end earlier this month when Count ington Police Department. was kept for comparison purposes.' Mrs. Farrow was a member of, Three died in miscellaneous mis- the Farmington Episcopal Church/ haps. e and the Farmington American Le- gion Auniliary. Those who died in pre-week- — surviving besides her husband end accidents were Theron A. are her mother, Mrs. Agnes Moule! Pearl, 26, of Eagie, fatally in- of Detroit; five children, Charyl jured when his car and another jLou, Ronald William Jr., Joseph sideswiped on a curve in U.S. [Larion, Gordon Jay and the new 27 at Lyons Lake, and Maynard (baby, Patrick Henry. P. Simmons, 34, of Climax, kill- | Mrs. Myrtle Sheesley of Alpena, ed when his car went out of (a sister, is living in Alpena. | control on Stone Jug Read mid- | The funeral will be held Monday Se FARMER ON ROOF WAITS way between Battle Creek and at 2 p.m. in the Farmington Epis- ‘I've Never Seen copal Church with the Rev. James isola weekend fatalities in-| ‘chow a0 Contary Ar Tony Fontain, 31, Millington, killed Friday near Millington when °¢T#! Home, Farmington. his car veered off an intersection. J. C. Boyd, 32, Davison, when be Mrs. Edna Sarah Fisher ship Friday. Emil Hansen, 42, Detroit, kill- (Associated §Preas B. Guinan officiating. Burial will Such Utter Ruin ‘rangements ar¢ by the Thayer Fu-' Anytime Before’ buildings were swept out into the’ Pacific ronan ont 59, Detroit, was| Church estigation of man-| gurvyi; brother, Russelt |Ocean. slaughter. Brady of “Columbus Ohior’ thres| Bad as it looked to me yester- ees sisters, Mrs. Ida Payton Cam-|4ay, almost everybody I talked to Jacob H. Grable, 82, Cooper.| bridge, Mrs. Goldia Johnson of|*@ killed Friday in a two-car col-| Washington, D. C. and Mrs. Grace|, “But you should have seen it lision on U. S. 31 north of Kalama-| (Phillip) Ammons of Pontiac. a =00. Service will be held Tuesday at| DESCRIBE THURS Homer L. Monroe, 53, Lansing,|2 p.m. from the Providence Mis- vay , Saturday south of Lansing|sionary Baptist Church with the| Tey ¢€xPlained that by mid- Rev. T. is better than all the other put “Together. I'll yee that angel waves her wand for one ETe,E* ane Zgast | devas = : 5 +E 8 z = A Z z za f e ae a armed with a pistol, held up a The men escaped down the rear alley after leaving through a side door, Detective Sgt. John J. Wil- liams said. vous the Fisher Body day the Center St., .| Born in morning Thursday the river was "\rising three inches every 10 min- Burial will be in Oak Hill Ceme-| 4, and houses were floating downstream, one after the other: By Friday the river had dropped from 12 to 15 feet and most of the house wrecking was over. » The effects still could be seen r Fist at places like Eleanor, a little eae a 26 e & He hed) community upriver from Sotia. {Only a few tangles of houses re- 5 c Se 4 S a & R z jand a school. : Coming here from Detroit 30), Hardly a house remained on its in the P gpaoraar —— of had washed onto the highways. Besides his wife, he is aS Miles of the highway upriver i d scrapers had gone past. Pontiac, August Gaubis Jr. of Li-|/"* vonia and Edward Gaubis of De-|,1¢ Ferndale bottoms, a rich troit wil]|der water. Only lonesome farm es to its bridge swept away. Word has been received here of 1 a ar ponmac, bt wno ter DetTOit Paper Strike tome in Pazader Catton, in Christmas Recess DETROIT u — Mediators said Pontiac. today they hoped to get at least Funeral services will be held onjone of three striking unions and blishers of Detroit's three closed . | Tuesday, December 27th, and bur-/PU land’s attorney and the Lapeer ial will be in Forest Lawn Memo-|newspapers together for a bargain-\County Prosecutor’s pffice had tg ing ‘ rial Park. ng session Tuesday. Orville J. Underwood The morning Free Press and denly yesterday at his home, 28 the strike later. Oxford By agreement, no pickets will be on duty at the three news- paper plants from 3 p.m. today until 5 a.m, Tuesday and no ‘| attempt will be made to resume publication during that time. The agreement’ was worked out Pontiac, Feb. 16, 1872, he 1900, Mr. Underwood attended Pontiac High School. He had lived a life-| time in Oakland Count and 15 years in Pontiac. A member of the Methodist, Church of Oxford, he had been! employed by the Pontiac, Oxford | Northern Railroad Co. and the Oak- by Police Commissioner Edward S. duty around the newspaper plants. s 2 be announced later. houses could be seen on top of the farm. sea of brown. | a Ferndale was | ted, - | H. B. Parks erndale was isola approach afternoon Times and News were Orville J. Underwood, 83, a for- | Closed by a walkout of stereotypers 11, cehed leaveliola mer resident of Pontiac, died sud- Dec. 1. Mailers and printers joined | 41g mean the onogy The publishers have reached OUT FLOOD — An unidentified farmer (arrow) one of thousands of victims of the Pacific coast's Surrounded home and waits for the waters to subside near Ferndale, flood disaster, presents a forlorn figure as he stands atop his debris- 25 miles south of Eureka, Calif. | NEAR DISASTER — Five men bound on a rescue mission in this small boat almost met dis- aster themselves on the Eel river near Loleta, 13 miles south of Eureka, Calif. Their motor ‘THE PONTIAC PRESS, SATURDAY, DECEMBER 24, 1955 AP Wirephote |Slate Special Yule Events ge 7 le. owe AP Wirephote them. Gilliland Still Free Pending Appeal | (Continued From Page One) | { ‘ he was the son of Mr. and Mrs (mained in river eddies. The tor- from a June, 1952 farmers’ tussle accident at U.S. 10 and Big Lake|little happier for 25 forgotten’ re- Felix Gaubis and married Amelia Tet took out a hundred homes with Lapeer County Sheriff Clark|road, .|Ruthenberg in 1900. | \Gregory and his deputy, Ronald, |Reedy, as the law officers sought) “This years ago, he had been employed foundations at Pepperwood. Some to evict Mrs. Stevens from her)15, also of Clarkston; and Joe are: Her farm, along with that of \Chris and Paul Ziegenhardt, had from Scotia still were covered with! : : by a daughter, Mrs. Helen Turrell) |been sold to satisfy creditors of the) Pontiac post State Police said) of Pontiac: three sons, Phillip of|three to six inches of mud pre Lapeer Farmers’ Mutual) Fire Insurance Association. | Claiming she was never a mem-| 7 dairy area near the mouth of the ber of the mutual, Mrs. Stevens) yield the right-of-way to William! Mr. Gaubis is at the Pursley|‘iver. was almost completely un-| had refused to pay a $172 assess- jment levied against her 80-acre illiland, who served the farm- as advisor and self-styled “investigator,” was sentenced to between 449-5 years imprison- ment for his part in the fracas. Motion for a new trial was dis- missed, and Gilliand sought to take his case to the state Supreme Court. But a lengthy delay followed while his new attorney familiarized himself with the case. Further delay came when Gilli-| agree to a factual] condensation of ithe conspiracy trial, to present to the state's highest court. Gilliland’s plea’ was two-pronged. , which uld re- was denied in July, 1955. He also asked the court to order jview his case and rule on it. This|now totals 21. Four Teenagers Hurt as Two Autos Collide ~ | Relics Become Toys Four teenagers were treated for {OF Children's Home cuts and bruises at Pontiac Gen-| eral Hospital last night after an| Christmas this year will be a tarded children in Lapeer County - .|Children's home—thanks to Mrs. Oe ee ee carentn |Darold Hillier, of 73 Norton St. : age. ‘| Mrs, Hillier is taking 25 toys to \the home. She’s been working re- pairing them since early last sum- mer. Now they're as good as new, but the driver of their car, James F.| hen ees started Riera Donahoo, 19, of 158 Chamberlain ey ene cog — roa St., was ticketed for failing to own five child she ; bat _ few were gathered from : io Lb eb CIE lOne of the friends, Mrs. Nadine |Ross of Pontiac Township, donated Ra Wadle Named the Christmas wrappings and y y helped package the toys this year. . Blind League Head Factory Worker Beaten Ray Wadley, 58 S. Parke st., by Unknown Assailant will head the Pontiac League for| A Pontiac Motor Division em- the Blind in 1956, it was announced pjoye is in Pontiac General Hos- today by James E. McClain, this pital after being beaten at work year’s president. (Thursday by an unknown assail- Others to take office at the Jan. ant. 4 meeting will be Oscar Tarket,; pontiac Police said James K. vice president; Ray McDonald, sec-|Roberts, 3812 Dunning St., was retary; Hazel Fuller, treasurer and struck from behind with an uni- Walter Sugg. member of the _ex- dentified weapon and then beaten ecutive board. lon the face, He suffered a frac- McClain revealed that the club, tured jaw, and- multiple lacerations Mullins, 18, of 101 Glenwood Ave., were released after emergency ‘reatment. designed to provide social con-iof the face and head, tacts and otherwise further the! An investigation has turned up ‘interest of the blind, acquired five no suspect so far, they said. new members in 1955. Membership | The group meets on the frst Tree Gunmen Loot and third Wednesdays of each the Lapeer County Circuit Court to as a right” based on a recent law. But Lapeer County Prosecutor between the publishers and strikers|George Lutz maiptaing that the third Wednesdays will be held at new law allowing stich appeals was| Piggins to give Christmas at home only under discussion when Gilli-| to policemen assigned to guard land was convicted, and was not |passed until after his conviction. Currently the action awaits the higher court’s ruling on a mo- h, at 8 p.m. tin if H grant his appeal, under an “appeal are. por a mol Geil Come the Eagles Aerie \Crippled Children’s Society, 152 W. tions closed yesterday. a swim party Friday, Dec. 30. cand and tbe tna nlneed tackwars in he |Cowmill Operator : Dies in Royal Oak The Day in Birmingham . Churches, Clubs, and Y atte i i i : fhe F s F ¥ iy g E fe ey l H i the Dr. Ormond lounge ot Deer Runs in Street movies and refreshments will fea-i¢ - 9 0 gregs ture the featvitis for all Y’ mem fOr [nia Citizens On Thursday, the ‘Y’ will run | IONIA (#—People here rubbed i é s 5 4 Santa Claus had arrived ahead of time. For walking big as you please down main street was a young, four-point buck deer. for all the world like one of Santa's. It was quite tame, too, The people petted it and fed it candy. On Friday morning, a trip is| Someone suggested calling it planned through the Pontiac Mo-| Dancer. tor Company leaving Birmingham aoe YMCA at 9:30 a.m, and returning| But then it was discovered his The Troy Hi-Y Club will have the Ionia County Park four miles The ‘Y’ will again cooperate State Bond Sales Hit $300 Million for Month DETROIT W — Michigan resi- dents purchased $24,300,000 worth S. Edward McKinney, 1261 al-\% ©-5: savings bonds during No- bany, Ferndale, who operated a 2 Birmingham sawmill for years, died yesterday in Royal Oak, after, Department's U.S. savings bonds a long illness. He was born Oct. 1, 1870, in Southfield Township, and was a|Tought to $300,199,000 the total of member of the Southfield Township| 8eties E and H bonds bought by Reformed Presbyterian Church. 1 months of 1955. In the same pe- For years, he owned and oper- |riod last year, $260,772,000 worth ated a sawmill at Baldwin and of the two series were bought in Maple in Birmingham, beside | \ichigan. which stood hig home. Its opera- tion was discontinued about 30 . ° ° years ago, and he went into (Injured in Accident Joseph Shiraka, 28, of Waterford Township, was treated for knee injuries and released from Pontiac General Hospital last night after an Also surviving are: a daughter, accident on Union Lake Road near Mrs. Frank Fortt, Royal Oak; two!Cooley Lake Road. other sons, Edgar P., Miami, Fla.,| Oakland County Sheriff's depu- and L. Clifford, Seattle, Wash.; six grandchildren, and two sisters, Mrs, Verna Patterson, Baldwin, | OO ee oe ane at More State Tourists 1 p.m., at Bell chapel of the Wil-| LANSING (INS)—Robert J. Fur- liam R. Hamilton Funeral Com- long. executive secretary of the pany, with interment in Southfield|! lichigan Tourist Council, says the Reformed Presbyterian church-|state’s tourist business this year yard. - was 10 per cent above that of 1954. road, hitting a tree. Sl) Po THRILL INSURANCE PONTIAC FOUNDATION their eyes yesterday and wondered . whether ties said Shiraka’s car left the | ¥awrence. During January, Feb- ruary and March, meetings on the COLDWATER (#—Three gunmen held up the Eagles lodge in Cold- water early today and fled with Wm. W. Donaldson Insurance Longfellow School, where the Pon-|$750 loot after pistol-whipping one tiac Lions Club has scheduled man who resisted. square dances from 8 to 11 p.m.| The armed men entered the —_— barroom of the lodge in this; Five Persons Hurt -|pressmen and the paper and plate agreements with two unions, the! gon ¢) mandamus the lower room to lie face down on the floor. The Weather tenigh te snew flurries and —— colder afterncen or nigh Low tonight 8-42, high temerrow 42-46. Seuth te southwest winds 15-20 m.p.h. Teday in Pontiac Lowest temperature preceding 8 &.m. %. At @ a.m: Wind velocity 15 m.p.h. Direction:. West-southwest Sun sets Saturday at 5:04 p.m. Sun rises Sunday at 8 am. Moon sets Sunday at 3:55 a.m. Moon rises Saturday at 1:17 p.m. |48\Mrs. Herman Wendland Besides his wife, he is survived|)andiers. court, according to Lutz. Meanwhile, Federal District -grandchild |\HeB Aes saving ae th brothers, | He Bounces Bad Big Boys - Clyde Underwood of Pontiac and} William Underwood of Ann Arbor. | ° a Good Tiny Boys PROVIDENCE, R. I. w — By Service will be Monday at 2 p.m. | lin the Flumerfelt Funeral Home, Oxford with the Rev, Fred Clark and girls on his knee. By night, he bounces bad boys out of a downtown dine and dance place. Howard Douglas Darling plays Mrs. Herman (Barbara) Wend-|the dual role of a department store land, 74, formerly of Pontiac died|Santa Claus and a night club de- at the home of her son,|corum keeper. endland in Manistique.| He needs no pillows or other padding as Santa Calus, nature Born in Germany Aug, 10, 1881,/having endowed him with a 44 was the daughter of George|waist. He needs no help as: a . bouncer, nature having blessed a member of the Pres-|him with a height of 6 feet 2 and Cemetery. ,|byterian Church of Duluth and the/258 pounds. Surviving are four children, Mrs. \Frank Richards of Cooks, George Pray by Rays jand Herbert, both of Pontiac,) LUCON, France (INS)—Villagers Manistique, six grand-|in Chaille Sous les Ormeaux in children and four great-grandchil-|western France will be comfort- dren. « able at midnight mass on Christ- Eve because of modern sci- by infrared rays. - 4 officiating.’ Burial will be in Oxford day, he bounces good little boys) Ziegenhardt and Stevens farms at 61, . The village church is hea’ read Court Judge Arthur F, Lederle has granted a motion to dismiss the complaint of 10 relatives of the late ‘Mrs. Stevens, seeking $250,000 |damages and return of the farm. | Named as defendants in the suit |were Grace S. White, Lapeer at- itorney who purchased both the sales; David A. Forbes, former re- iceiver of the mutuad association, and Charles A. Stier,Fred C. Bal- 1 St. Clair Deputy Dies ‘southern Michigan city et 12: 39) in 3-Car Mishap a.m. They ordered 4 men in the One driver was admitted to St. Joseph Mercy Hospital last night and four other persons treated after a three-car accident at Tele- graph and Ward Rds. in Bloom- field Township. Robert L. Milner, 25, of Royal concussion, authorities said. Mil- ner’s wife, Adelaide, was released after treatment, as was a second driver, Fred B. Hoenstein, 101 Henry Clay Ave., and ald Barret, 191 Ottawa Dr. The third driver, Wilber S. Awrey, 1545 Island Ln., was un- injured, police said. Bag-Snatcher Grabs Purse, $30 in Loot | A Christmas purse - ‘snatcher grabbed a woman's purse out of her hand yesterday at S. Blvd. and Franklin Rd. and ran off with the $30 it . Mrs. Willie Caraway, 172 Mo- hawk Ave, furnished Pontiac Po- lice with a description of the thief, but said she did not know who he Oak Township, suffered a possible| passengers Charles Bullock, Detroit, and Don-ly After rifling the cash register, the gunman told the lodgemen to get up and pass a designated spot to give up their bilifolds. George Bennett, 40, resisted. One of the gunmen bashed him on the forehead with a pistol. The gimmen then fled in the darkness. Bennett was taken to the Branch County Health Center in Cold- water for treatment of a scalp injury. His condition was listed State Office to Close May the coming Season bring to you and your deserve. May we continue to serve you in the 23_N. SAGINAW ST., PONTIAC y i's * _THE PONTIAC PRESS, SATURDAY, DECEMBER 24, 1955 THREE A eeven-nfile tunnel cut through|D)- a4 (tf ' r iaht (Busi , 90, Di win erent tunnel ut tere Post Office Workers Extorter’ of Knight een eo uc] PONTIAC MOTOR Will Answer Prayer Freed Under Bond Taggart, one of Michigan's oldest) 4% “Pelé on Savings active businessmen, died Feo Pons. ah wectos Siete wn at the age of 90. A native of Workers Eligible LOUISVILLE, Ky. ‘The wom- MIAMI, Fla. —Peter Napoleon). Scotland, re came to Port Huron} 850 Joslyn St. .. ..FE.2-0296 To Our Neighbors, Patrons and Friends DARRELL DRUG STORE 37-39 8. Saginaw is on ease reliet. She ended the . F letter writing: ingen a Sincere Wish cme is more of a prayer to or Continued Happiness, tase Giese It : dead-letter box.” Good Health and Prosperity =i jan addressed the letter to Santa Claus but put her. faith in God. The letter, sent by the mother of two boys, one 4 and one 6, asked for a Christmas gift of ‘just Williams, charged with attempting gt 19 and had been the owner of. to extort $600,000 from John S.' a jewelry store here since’ 1888. : | Knight, editor and publisher of the - Miami Herald and other newspa-| : ; pers, was freed in $10,000 bond yesterday. * * | The 20-year-old youth immediate- | ly entered the psychiatric institute at Jackson Memorial Hospital. He had been held since Dec. 16, when he was arrested on a charge of attempted extortion. He was) taken into custody by FBI agents’ when he picked up a box sup- Signs of the season: good cheer, warm friendships, light hearts, high happiness, deep contentment .. . it is our sincere wish that they may all be yours in fullest measure this Christmas and the Coming Year! A eo yooonce ony” posedly containing the $600,000 . | said amily wou ave its The FBI said he later admitted | Christmas gifts. | writing a letter threatening death DR. H. A. M | LLER ! == a ee = _ . = ito Knight's family if the money . j | = = = lwere iol paid. . OPTOMETRIST | ‘ee 8 “Better Things in Sight" Williams was taken to the psy- , . | ‘chiatric institute by his father, the FE 4-6842 7 North Saginaw St. { STUDY DETECTION METHODS — Lt. Joseph Koren (rear) of Rev. Peter Williams Sr. the Pontiac Police Dept. looks on as Patrolman Michael Kepchar, = —— of Gary, Ind., takes one of the tests given to drivers suspected of being under the influence of alcohol. Lt. Koren is one of 29 law- - — — : — ——— enforcement officers currently enrolled in a nine-month training program in police administration at Northwestern University. Ger- ald O'Connell, training director, stands at the right. ‘Dies of Crash Injury in mpo 1 fl DETROIT #—Charles Davidson, ja Detroit salesman, died yester- . . lday of injuries suffered in a two- Works in Prison \car collision Wednesday. He was ithe city’s 213th traffic fatality of ithe year. Fourteen more had died Man Suspected Posing of the same date in 1954. as Korean War Surgeon Frogmen salvaged a helicopter ° |\which fell into 20 feet of water in . | Vanishes From Job 'the Chichester, England, harbor. , There w Ities. | WE HOPE THIS CHRISTMAS WILL BE ESPECIALLY | HUNTSVILLE, Tex. a9 — Texas oe | PLEASANT FOR YOU, YOUR FAMILY AND FRIENDS. [prison officials were still talking today about a fellow worker ‘they ‘liked and respected who turned out to be accused as an internationally; FLOOR COVERINGS known imposter. about your future training or Me | the kind of work for which “We've got nothing against him} you are best suited? and personally I wish he would § - come back,” said one official. ‘“‘He was a damn good worker.” VISI | FBI Agent Arthur Carter said today “there's no question in my THE VOCATIONAL mind” that the assistant warden) who disappeared early yesterday’ COUNSELING SERVICE was Ferdinand Waldo Demara Jr., e a native of Lawrence, Mass. APTITUDE TESTS 3511 Elizabeth Lake Road He said he found some clothing po. locical M t \with ‘“‘Demara’” as a_ laundry srchelogic cooemee |mark. 716 Community Net? Bank Bidg. = General prisoner manager 0. B.| Pentiae, Be pps |Ellis called the assistant warden) Phone 5-2436 to his home late Wednesday night lafter a prisoner noticed a dene 5. N. Geal. Director jto the prison employe and a pic- MEMBER: ture of Demara in a 1952 magazine. The man, assistant warden of the § Nattenal Pergonnel and Guidance Association segregation unit at the main prison, Web a 7 rr ’ Ceuta | here, denied he was the same man. Association |He left Huntsville a few minutes: Michigan © Al en ‘later, é (Over Twenty Years Experience) * * j Nothing has been heard fon SEE the employe since then. Prison offi- ¥ en cials said they had not asked any-| lone to look for him. The FBI, | lagent said he knew of no charges ‘ e jor hold orders pending against the! ‘man. The- employe had almost a month's pay, about $300, due him ¥ jand left a small balance iny ‘a Huntsville bank account. He still ; owes about $100 on a television|y 'set and an air conditioner and has ‘about 18 more payments on a car! purchased recently. d Demara caused a furor in 1951} after serving as a surgeon on the! Korean battlefront. The Canadian) navy said he enlisted as Dr. Joseph! \Cyr of New Brunswick. who later was found to be a different man.| Demara, then 29, was discharged) and deported from Canada. His; father said then that his son's only previous medical experience was) as an orderly in a Boston eye and| ear infirmary. | Michigan’s Largest Jewelers 24 N. Saginaw St. . LJ The Texas prison employe came to Huntsville from Houston where ihe had been employed by a hotel jas an accountant. | Elephants Kick Kids | SANTA BARBARA, Calif, w—¥We have enjoyed serving An excited, trumpeting elephant. yen during the past year. \kicked two children at a Christmas) jparty but the youngsters escaped) \WOHLFEIL-DEE with only severe bruises. The ani- mal became alarmed yesterday when some of the 400 children at'y ENGINEERING CO. ; an Elks Lodge circus began shout- | ing and throwing paper gliders. 2270 Tolepegh Read [Renee Lister, 6, and her sister} FE 2-4907 ah \Phillis, 13, were kicked, | > a s.45 5555 “Hark! the herald angels sing... Guts CHRISTMAS, as we rejoice in the commemoration of the birth of our Lord, let us remember the good his teachings have brought to all mankind. oo -ncan eigen Dar our HEARTS be open this Christmastide to His message that | BN by the power of God's love alone cfn we BS . : i ; - \ be inspired to great deeds and wise action. Re rae 7” \ - All the 2 Ny Detifous| ‘te Maple Leaf Desserts May ‘this Yuletide be the merriest ever for you, your family and friends. GREETINGS — he. TA) and\ Loan Association 761 West Huron Street ‘to each of you from all of us at x | ya COMPLETE BANKING SERVICE 16 E, Lawrence 5 407 Main St. Map le Leaf Dair Co. SAGINAW AT LAWRENCE Downtown SHR ee an 20 E. bee ae Ase AORN HENCE ESS, SATURDAY, DECEM of insurance there. Indian Chambers of Commerce' THE BERRYS are opposing the nationalization . THE PONTIAC PR -GENEY | DRY—CLEANERS | 12 W. Pike St. g) | “TWAS THE NIGHT THE HOUSE ~ | | BEFORE CHRISTMAS a] i ee Oe By Cari Grubert x Zany Changes in 2000 A.D CHICAGO (B® — Women traffic Many editors foresee a spiritual ‘cops, moving sidewalks, an 18 S'eater kindness, charity and_ tol- hour work week and more people ST@C® toward his fellow man. | ; A sour note: jbut fewer farmers . . . : | These are some of the things Rt tl “We ought to have our. house jIllinois and Indiana newspaper edi- ee, Sled es sald one ines \ tare | foreese in the year 3000. editor, “and the income tax blank | ’ will be so long, they'll have to | _ At the recent dedication of the issue it in installments." | atatry Insurance Co.'s new — potent Alan renin tlio pukaee--Car Struck by Train _ two states made predictions of | GREENVILLE i» — A mother a what life would be like in their and her son escaped death. Thurs- respective communities at the day when their car was struck by | . ee turn of the 2ist century. a Tl-car Chesapeake & Ohio freight, | The predictions were micro- train and dragged 600 feet. The TO YOU-YOU AND YOURS PHILIP’S filmed and sealed in a time cap-4river, Mrs, John Ekholm of sule in the building's lobby to be|Greenville, suffered a broken hip. ‘opened in the year 2000. And Pru-|Her son, John, escaped with cuts dential’s statisticians summed up|@d bruises, ‘the editor's views. This is the pic-) ‘Newspaper Editors See S Stations to Close DETROIT uw — An “overwhelm. ing percentage” of gas stations in group, said motorists are urged,” * Michigan will be closed on both ‘to purchase gasoline needs early, © Christmas and New. Year's Day, so as to avoid any inconvenience « the Retail Gasoline Dealers Assn.'due to the holiday closing.” ‘of Michigan reports after a state-|)- wide survey, John W. Nerlinger ‘ Jr., executive secretary of the! ture they came up with today of \life in the adjoining states 45 years! One Policy ifrom now? ymen | SS APLENTY | One Pa : Education—Teachers are well. One Expiration paid, and there is no longer a One Bother teacher shortage. Public school’ Th H , classes range between 20 and 25 students. More emphasis is placed) On ve oe feb boancbedrctha on the liberal arts in universities. _" ’ Economics—Atomic power has Thatcher, been harnessed for everyday use. Consumer purchases have __in- Patterson in 1955 to $10,000. Homes are de- signed for push button living. Dad, |"™ May the jeys of Christmas brighten your heerts during this Christmas Seeson end throughout the New Yeer to come! creased from $5,000 per household & Wernet 839 W. Huron (Corner Palmer) ts | __| | H i BER 24, 1955 EE ACS EO, ME NO 6 8: As we usher in the year-end holidays again, we tecall the loyal friendships and cordial relations enjoyed in the year just closing. We take this time to express our sincere a for your patronage, AND A HAPPY NEW YEAR! BUSINESS ETHICS BOARD of the Pontiac Chamber of Commerce cs baw: We: ke SOO; E.G Mimi 3 working only 18 hours a week, is ‘trying to make more effective use of his leisure time. Traffic depart-| ment is manned solely by women 79 N. Saginaw St. ‘munities have almost doubled in. population. Farming—A population which has increased to 275 million had eliminated the problem of farm surpluses. There are fewer farms than in 1955, but these are pro- ducing far more than 45 years | ago, Farmers have developed a more meaty hog as fats and oils are now being obtained from syn- | thetic sources, Medicine—Scientists are awailt- ing momentary announcement of jeures for cancer, tuberculosis and infantile paralysis. Accent is now (placed on preventative medicine rather than curative. Sports—major sports are played indoors in glass-roofed stadia. A ‘an bd fj ted leis lass has Le ‘aa eC ade ais sisal plaice. ° Transportation—helicopters and CH R | STM AS monorails are a major means of itransportation. Moving sidewalks |transport pedestrians along the |streets. Scientists have just an- owe , {nounced the first landing on the’ aioe bil, Aut, ret] s are We'd like to pause on the special powered by atomic and solar en-— thought that Christmas jey ergy. Luminous roadways make end happiness. Let us pray for centrates have replaced gasoline. peece on eerth.. . goodwill caanse aol towards all meni Order Vote Machines . . KALAMAZOO: () — Kalamazoo city officials have decided to rent Calbi Music Co. | voting machines for 32 pre- cincts, The rental is to apply on 119 North Saginaw St. the purchase price if the city buys them. The action means three- fourths of Kalamazoo County will) IA RA ANAS fr have voting machines for the pri-| ow oO oe Vo Wo WN iidry election next August and SS the general election in November. q We would like to extend at this time our best wishes to | you and your loved ones. May yeur Holiday be a merry one and filled with goodwill! May the New Year bring you peace, success, and happiness! From All the Personnel at CASH MARKET \police officers. Most of the com-) Morrah fommehfoavehfemnechfemmadipeswachfeswech feswohfosccdh je} LEARANC _ Many items reduced up to Gun Dg Sen VA off 2 iinet SRS”: Cites ~ = eo ee uv SE PRA aS RE ee ES ¥ THE PONTIAC PRESS. SATURDAY, SECEMBER 24, 1955 : : FIVE. Milk Output Rises TODArs see oe Yule Tree Cites Founder Amebrica. The tree is decorated) Medical Grads Set Record mse | JUNIOR EDITORS | sis" te scmmecscoerss cme mena S ended last June 30 climbed 2 per | Christnias tree from St. Paul.| accompanied by a cash contribu-|Proved four-year medical schools } t over the year before, but was | atinn. is on display at the birth-\tion to be used to renovate the | graduated 6.977 physicians in still 6 per cent under record-break- place of Mrs, Juliette Gordon Low, loses as a national Girl Scout/ 1955, the sixth consecutive year a ing fiscal 1963. The Christ Child —— ss ay \ i |founder of the Girl Scouts of'shrine, | graduation record had been sets F - | : : : Your Wateh| Gq ) r Cut out this figure te ‘ ou qd C meke your criche. cami . Share sq* e Deredated ri rt e ; 41 Expansion v5 a ote | | Watch Bands Hareld Davis Glenn H. Griffin Philip Wellemeyer ; 4 a Ladies'-Men'‘s a Our sincere wish for all the : , From the Boys ot the... a $ pS neere Nes for satiate | 4 4 1 95 families of our community ts a | 4 : : SPOR I S SHOP ‘ Special happy and joyous holiday. ; 4 ! Geo es-Newports We also want to express our appreciation for the confidence of the . ; 16 S. Cass i ! 0 : many families we have served in the past. Our constant growth makes | ne AHAHDAD | lewelry Dept. us keenly aware of our responsibilities in the future. é : ; Gparks-(Hriffin | uneral Home — — — “Thoughtful Service’ z 46 Williams St. Ph. FE 2-5841 Sea== = oo See —— The Christ Child The Christ Child in the manger is the last picture in the Christmas crib series. Color the picture, paste it on cardboard and cut it out care- r om LO fully. ' The straw under the warm quilts is yellow. The sheaf of grain at the bottom is a deeper yellow. The manger in which the Child lies is a. ] : low, wooden box, meant to hold food for farm animals. | ANOTHER GRESHAM rmST! On the floor are some of the gifts which have come to Him. Pure, | ; clean water, a treasure in a dry land, is in a crude jug. That and the} Give a Gift Certificate for any amount, that is sheaf of grain are the gifts of the poor shepherds. Beside the water redeemable at any time. For laundry or dry stands a cagket of incense and below it a tray of jewels, the gifts of : : ihe ‘Wine Mea. | cleaning. Ask any Gresham representative Fold the center part forward, the outer ends of the base backwards | about our Gift Certificates. so the picture will stand. The other cut-out, the star, should also be colored brightly and hung | ‘high above the crib, as if it were high in the sky. | Then, take all the figures and arrange them, as shown in the first | Ls ipicture, in a group about the Child Jesus. 9) | Monday: Your Calendar for 1956 5D Shi ress irts Electric Chair Kills Germen Police Loaded omy $713 . . fs ‘With Christmas Gifts 1 CASH AND CARRY Criminal as He Faints | ressxrunt, cermany wn —| Amid the geyety of the loom traffic cops are going | EDDYVILLE, Ky. — Chester home these days loaded down! S AVE 10% ° Merrifield, t outlaw in a holiday season may we life ra Napa faioted. in | ren ecnmnehe. wines, whisky Gal : ——— pe electric od and was put t0/ from persons who pass the cop BRING YOUR pause and remember the pconsciousness, | aly EMERGENCY SERVICE ON REQUEST CLEA ing ——— Americans, who back home| NING TO OUR } He died for killing Louisville ‘might have regarded such gift : 7 | a ° f Ch . : Policeman Alvin Keown, igiving as open graft, are joining! 2 NEW DRIVE IN @ meaning o ristmas. The 37-year-old Louisville gun-|in the German custom. AND SAVE 10%! man, crippled in a gun fight with Keown in a night club parking lot ‘ chamber on crutchee. : DRIVE-IN CLEANERS chamber on crutches. ‘ os : Warden M. W. Thomas said MYER’S . Merrifield fainted as he was being Get Acquainted OHer! 605 OAKLAND—Just North of Wisner Stedium Seon et Gee ” ermuler elur wut Cell FE 4-2579 for Free Pickup ond Delivery : Merrifield, who reputedly had GENUINE BLUE WHITE é KLAN | turned to robbing parties of social- 15 CED OND Branches: 328 N. PERRY — 97 OA D ly prominent persons before his + Ct AMON : : \ |brush with Keown, made no state- - oe iment in the death house. He gave Ve ae v4 the warden a written statement for i> S75 Ss tater Ae aC r release after his death in which < \ il ae ® $ ne denied killing the patrolman. S ij »Y A® y 'Ex-Hobo Remembers 8 8 MY, Hf, ee Police for 1933 Deed KY aes PENS Le: a ALBANY, N.Y. w—Perhaps the e of | most prized Christmas card re- ea }| received at Albany police head- : #4 F. © quarters was one sent from Long , Pe 98 Search N.J., and signed, “From ‘ RS *s|a man who never forgot.” i Le ‘| The card read: aa “Back in 1933 when I was on ap a | the bum as a hobo, I never forgot i. = how nice I was treated by your ae © | police department, : “I was cold and got a place to oe seep with lots of kindness. So I 2 . «| Want now to extend my Christmas OPEN EVERY nS fe and thanks.” | NIGHT TILL CHRISTMAS ; | < | oyous = hs al = 2 a | e . . = as aL Gristmas> ab . = a _| At this ame of the year, se all hearts are in tune ie with the spirit md We wish a Joyous % Holiday to all. . a | FROM ALL OF US! TO ALL OF YOU Way we extend our sincerest : p wishes for a joyous Yule- ® tide Season! Our friendship Horsedrawn carriages are a thing of aa grewa:tncoagh (ke earn and we truly thank you for your the past, but wishing our good. friends — : , generosity and patronage. May the eee “ future hold greater stores of 2 prosperity for you! ‘everywhere a Merry Christmas Frank and Jeanette Slaybaugh |, will never be out of style S] ! a9 , 7 % aybaugh’s jj f | ( ~ : : 6} ) SPORTS SHOP | a we open —- : ad | ; 5 z wt oR 130 Oakland Ave. —-——~Phone FE 8-0453 nas ; ; os < : : a . a es ‘ . a i i F ! i q ’ = er DPD PBDI DDD DDI Pde ‘De De Re De De Re Bee Ree Bel ; ie : La ot oy : WS a av 4 } : + ne “ a * * \ > ' i A \ * ‘ ‘ & 1 * re 1% ; * ‘dt ‘ * + ' i gees eme ee « dew ee es meee +s se eee ee se Sse wee ee ewe es Sey ee ee ee ee ee THE PONTIAC Lied staiat SATURDAY, DECEMBER 24, 1955 “THE PONTIAC PRESS Trade Mart - Dafly. Rxcept Sunday Published thom = Powrme Bee Bullding pape Rousset. Bassett hanstieg Manager Nat'l Adv. Mer. Entered et Post wffice, Pontiac as second class matter MEMBER OF THE ASSOCIATED PRESS The Associated Press is entitled exclusively to the use tor republication of al) local news printed in this news- Paper as wel) news dispatches. Tus Powrisc Parag ts delivered by carrier for 40 cents @ Week; Where carrier service is not available by mail Phone “pontiac PE 2-818 MEMBER OF AUDIT BUREAU OF CIRCULATIONS SATURDAY, DECEMBER 24, 1955 ‘Christmas Greetings Once again we of the Christian world have reached the eve of a most joyous religious festival. It is good on this happy occasion “to think anew of the true meaning ~like ours could believe that. of Christmas. Not only is it the birth- day of Curist but the day of days for children, a time for gift giving and for Peace on Earth and Goodwill to all Men. * * * Some mistakenly have come to believe the day has lost its meaning. They fear its spiritual value is gone. But no one privileged to watch Yule- tice preparations in a community The sight of throngs of gift laden men and women and the eager expectant faces of children are inspiring proof that the real spirit of Christmas still lives. x *&« Our earnest hope is that the peace of Christian charity, under- standing and brotherhood will spread throughout much more of the world before another Christ- mas season. In this spirit we of the Pontiac Press family wish our ever growing circle of readers and our many friends the happiest and most joyful of all Christmasses. Ten Dangerous Days In a spirit of helpfulness we re- mind motorists that they are enter- ing the year’s most dangerous traffic season. - * * * Just to emphasize the point, con- sider the predictions made for the 10-day Yuletide period by the Asso- ciation of Casualty and Surety Com- panies. The association isn’t guessing about such things. Its predictions are based on adequate records. Hence it forecasts that: During the Christmas weekend 390 persons are likely to lose their lives in traffic crashes. Over the New Year holiday even more, 410 may die. Between the two holidays another 400 are expected to be killed in traffic. In addition to forecasting these 1,200 deaths, the association is pre- dicting that no less than 30,000 per- sons will be injured between now and January 2. Warnings issued by insurance associations alone can’t do any- thing to reduce this terrible slaughter. But everything careful motorists do to avert tragedy can help a lot. Don’t be one of the 1,200 who will die. Remember when you gamble with safety you bet your life. Abuse of U.N. Veto ' The free world is likely to hear a lot for some weeks about how Russia made it possible for 16 countries to become new members of the United Nations. It is true that the Kremlin's last minute shift of policy did open the . way for U.N. membership to grow suddenly from 60 to 76. But just to keep the record straight, neither we nor our allies should allow the Com- munist bloc to forget how Russia has abused the veto. . * x * The truth is that had not Russia ~~ barred the way, most of these 16 nations would have been members many years ago. Further, if Russia hadn't proposed membership of Outer Mongolia, which doesn’t rate such status, there never would have. been any long impasse over membe-ship. . Just to show who has been guilty of abusing the,U. N. veto, the record shows that the United States has yet to resort to this tactic. On the other hand Soviet Russia has used the veto 76 times in 10 years, Sudan Now Independent | It may be only of mild interest in advanced countries that the world’s newest independent nation is what we used to call the Anglo-Egyptian Sudan. But it is worth noting .that this development came as the result of unilateral action by the Sudan Par- liament..It also is important that it had the approval of both Britain and Egypt who have shared the task of guiding the political destinies of the — estimated 7,000,000 Sudanese since 1899. x * * This sudden declaration has had the effect of ignoring a plebiscite on independence previ- ously scheduled for next Spring. But neither Britain nor Egypt objected when it became apparent that all Sudanese political parties were unanimously in favor of independence.’ | One of the new country’s big handi- caps is the vast difference between its north and south. The people of the north are educated and progres- sive and are Moslems. Those of the south are largely illiterate, primitive and pagan. xk * * In the Sudan is a perfect illus- tration of how rapidly national- ism and anti-colonialism is spreading in the so-called back- ward countries. The Sudanese will face many prob- lems in- drafting their constitution and organizing their government. Older and friendly nations can join in wishing this newest nation a long and peaceful history. The People’s Business They Also Serve Yule Is Time to Remember Our Faithful Workers By JACK I. GREEN LANSING—Government is governors and senators, and legislators and politi- cal figures—men whose every word rolls in headline echoes across the state. * . * And government is also the clerk and the secretary, the policemen and the fire- men, the bacteriologist and the teacher —whose words seldom are heard but whose daily action helps us all. So on this birthdate-a Humbie One, let the people of Michigan -honer the humble ones of govern- ment, the little people, our servants. So— Christmas greetings to the guards in our state prisons who walk the-cold halls on Christmas Day, forgotten soldiers in man’s slow process of civisization. ° * The best of Yuletide wishes to the at- tendant nurses in the mental hospitals who will spend the Christ Child’s day gently caring for those. whom the an- clients called the “forgotten of God.” PRAYER OF THANKS A humble prayer of thai-ks to the men and women who on Christmas Day in the morning will blink back the tears as mindiess little ones stumble past the gleaming tree in the corridor. Our thanks to the police sergeant who leaves his own tinseled living room to sit beside a telephone and await our call for help. Greetings on this day to the State Policemen and the Sheriff's Deputies whose watchful eyes click off the miles that all of us may be together another Christmas in safety. May the Christ Child spare a special glance for the firemen celebrating an- other Yule in their dingy stations. ° ° * Give a passing thought to the skipper and men of the state ferries whose Christ- mas Day will dawn across the gray-black chill of the Mackinac Straits. Our gratitude to the Mackinac-clad road crews who will plow the highways to grandpa’s so that our children may sit beneath the tree where once we did. TEACHERS, TOO May there be a special treat in the stocking of every man and woman who teaches our children to be wiser than we are. ° * * Here's a clasp of the hand for the ele- vator inspectors and the food inspectors and the factory inspectors and the elec- trical inspectors and the plumbing inspec- tors whose year-long vigilance has pro- tected us against man’s inhumanity to man, Hefe's to the men who settle strikes and regulate our railroads and con- _ serve our soil and keep our waters clean. ; Blessings on he nator Guardsmen who forsake their homes one night a week to practice che arts of war that we may live in peace, _A thanks for those whose Christmas dinner will be spent ina lonely booth’ watching the skies for enemy planes. ° i ee The Pontiac Press Days of All Faiths Customs Brought From Many Lands Enrich Yule Tradition in New World By Dr. HOWARD V. HARPER Saturday, December 24 — The Eve of any festival is supposed to. be a solemn vigil, but two Eves’ have lost nearly all traces of such serious tone. One, of course, is Halloween, the Eve of All Saints Day, and the other is Christmas Eve. The joy of Christmas can’t wait. It spills over into the days and even weeks preceding the great day and reaches such a happy peak today that Christmas itself is al- most an anticlimax. No single 24- hour period in the year is so rich in custom, lore and tradition as Christmas Eve. It is tonight, for example, that cattle and horses have the gift of speech and sheep go in a cessions to commemorate angels’ visit to them and = shepherds on that night long ago outside the village of Bethlehem. Tonight the beasts in their stalls and the wild animals of the forest. will kneel and adore the Lord of ‘all Creation. All day the bees have been humming the 100th Psalm, “O be joyful in the Lord all ye lands.” No evil spirit will be out tonight. For weeks now cocks have been “crowing for Christmas,” crow- ing. that is, with special volume and vigor to frighten the spirits away. Nevertheless when your clock strikes midnight tonight, it would be a good idea to open all your doors to let out any spirits that have been hardy enough to with- stand the cocks’ raucous threats. But you needn't worry at all about ghosts. They definitely never appear on Christmas Eve. Armenians must have spinach at... their supper this evening. They dg this in honor of the Blessed Virgin who herself ate spinach on the night before her Baby was born. In Bohemia (when there was a Bohemia) it was the custom to cut apples in half tonight, and if * anyone in the family found the Star in the center of his apple was a perfect one, it meant health‘and happiness for all during the com- ing year. In Rumania today husbands and wives have been out in the orchard. The husband speaks sternly to each one of his trees, threatening to chop it down if it does not bear better. And the gentle wife defends the tree, say- ing, “Spare this tree” and prom- ' ising it will bear better next sea- son, Christmas in the New World has been enriched by the customs brought here by people from many lands. Santa Claus, for example, is a Dutch contribution, brought first by the Dutch settlers in New York. The hanging of stockings over the fireplace can also be traced to the Dutch. whose children placed their wooden shoes in a row on the hearth for Santa to fill with gifts. English and American children were astute enough to substitute their stockings — shoes won't stretch, but stockings will. The Christmas tree came from Germany, where Martin Luther is said to have started the lovely cus- tom. The yule log goes back to pre- _ Christmas times in Scandinavian history, back to the feast of Juul, which was held at the winter solstice, Fires were lighted thén to symbolize the heat, the light and the life-giving properties of the returning sun. Our Christmas cookies come from, of all places, ancient _ Rome, where it was the custom at this time of year to present members ‘of the Roman Senate with these small confections baked in human and animal shapes. French people used to insist that as the Midnight Mass was ended another Mass begin at once, for the belief was that any child born between the Midnight Mass and the next service would lose his soul to the devil. If you will leave q loaf of bread on the table tonight after your evening meal is over, you can be sure of having bread on the table all through the coming year God . Voice of the People Leslie Morgan Would Like Drayton Drains Repaired Letters will be condensed when because ; iy will no be published if th #0 requests unless the letter ts critica! in ite nature To the taxpayers of Oakland County and especially those of Wa- terford Township who are interest- ed in the proposed water and sew- er systems: WA, ths Saxpayors te des vale: ity of the Drayton Plains drain ‘and Drayton Plains extension drain, wonder how long we will have to wait for the Oakland County drain commissioner and the Waterford Township super- Portraits By JAMES J. METCALFE Today is Christmas Eve, and now .. . We pray and mediate . Until that midnight hour when .. . We sing and celebrate .. . The midnight hour long ago . . . When Mary dear gave birth... To Jesus, Son of God, and our... Salvation on this earth . . . We join the shepherds from the hills . The Magi on their way . And — give our thanks ite . For one more Christmas Day ... And in our thoughts and prayers we wish . . . We could have been with them .. . Who knelt before The Holy Child... In ancient Bethlehem ... To praise Him and adore Him and . To ask Him to forgive... -The sins we have committed and ».. The selfish way we live. (Copyright 1955) THOUGHTS FOR TODAY Behold we put bits in the horses’ mouths that they may obey us; and we turn about their usta) bet) someee 3:3. * * Look carefully that love to God and obedience to His commands be the principle and spring from whence thy actions flow; and that the glory of God and the sal- vation of thy soul be the end to tes all thy actions tend.—Bur- itt. Case Records of a Psychologist Christ May Have Saved Christianity. in Handling of Two-Horned Dilemma Christ was the greatest ap- plied psychologist of all time, as the following typical eramples will indicate. Jesus saved the Christian Church by sidestep- ping the traps which his foes laid for him and thus enabled his 12 Apostles to gain an extra tp ah two of personal tutoring r his leadership. _By DR. GEORGE W. CRANE Case Q-330: When Jesus Christ was about 32, a group of Fifth Columnists in one of his large audiences decided to trap him. So they figuratively threw a two-horned dilemma at him, think- ing they would cause him to get into trouble regardless of whether he answered with a ‘‘Yes" or a “No”, tt * . You readers are doubtless fa- miliar with such two-horned di- lemmas. A classical example is the query: “Have you stopped beating your wife?" e If you answer ‘‘No”’, then the inference is that you are still beat- ing her. And if you reply with a “Yes”, ‘you indict~ yourself for previously _having beaten her. Yet actually, you may never have struck her in your entire life. This type of dilemma thus does not permit you te give a true answer, Christ's foes thus were sure they could lead Jesus into their baited verbal snare. So they asked if it was lawful to pay tribute *%to Caesar. If Christ answered’ “Yes”, they thought he would alienate himself with most of the Hebrews, who comprised the great bulk of the crowd, And if Jesus said “No”, then they would report that Christ was inciting treason and thus have him arrested by the Roman sol- diers. GREATEST PSYCHOLOGIST But Jesus saw through their de- -tion are on this coin?” And the audience chanted back “Caesar’s,”’ Then Ghrist gave that remark. \ able answer: “Render therefo unto Caesar the things that, are * Caesar's but unto God the things that are God's.” By this neat strategy he side- stepped their: snare and ithus saved For if a year or two earlier and thus sent to Calvary prematurely, his followers might not have been suf- ficiently trained and schooled in his new ethical outlook, to with- stand the tortures under Nero. So the Christian Church might have died out. JESUS KNEW PEOPLE At another time, Christ's foes sought to trick him, so they asked, probably with feigned innocence, “Whence cometh thy power?” This was another two-horned dilemma, for if he had replied that he was the Son of God, they would have reported him to the Great where such a claim to Divinity was deemed blasphemy and thus punishable by death. . On the other hand, if he had admitted that he was just an ordi- nary person, then they would have used that statement to disillusion the vast crowds. So Jesus, perceiving their evil intent, threw a two-horned di- lemma right back at them, though they didn't realize it for some minutes (Mark 11: 29-33). “And Jesus answered and said unto them, I will also ask of you one question, and answer me, and I will tell you by what authority I do these things. “The baptism of John (the Bap- tist), was it from heaven or of men? Answer me.”’ Then his foes realized they were trapped, for if they were to reply that John was sent from God, Christ would ask them why they didn't believe him. And if they said John was just an ordinary demagogue, the crowd would have lynched them, since the crowds thought he was a prophet of God. So they weakly replied ‘We cannot tell." and Jesus neatly an- swered, ‘Neither do | tell you,” for they had failed to fulfill the oral bargain, Always rit to Dr, George W. Crane in care ee visor to make up their minds to repair or waplug these drains, It has been one year now that our back yards have been flooded nbs eg aa aioe ee they cannet repair the drains we now have and keep them in work- ing order, We would like to plant some garden in a few months, but we wonder if the situation will be taken care of by then. Leslie C. Morgan 4749 Dixie Highway. ‘People Too Busy Buying to Say They’re Not Poor’ It seems unusual to me that there were so few answers to Albert Mills’ letter. But I guess people are too busy Christmas shopping, spending more money than ever before, ~ But Mr. Mills thinks the work- ers are getiing poorer. As for Mr, Mills’ theory, it’s easy to sit and pick out isolated situations te compare with beok-learned philosophy. But why didn't he cempare the workers here with workers in a system of govern- meat which practices Marxian principles? Let him go to Russia and make that $147 a day, if Karl Marx’ ideas are so great. It’s easy to sit down and read a book and then say what should be done, But socialist and communist countries prove that things aren't always so rosy in real life. As fer American workers “getting less and less of what they produce,” who do you sup- pose is buying all these new cars and TV sets and refrigerators? He mentioned Ford's mounting earnings .. . but it sure knocks the wind out of a lot of arguments against capitalism when the “big, bad capitalists’ take the profits and turn them back to the people through donations to hospitals and schools, as the Ford Foundation just did. I don’t remember seeing any Karl Marx followers making endowments of half a billion dol- lars at a crack, In answer to the question, ‘Did Marx err?” He sure did! dust Another of the ‘Starving’ Masses. Looking Back 15 Years Ago 19 VOLUNTEERS reduce Jan. 3 draft to 9 in Pontiac. SPIRIT OF Christmas rules fn America, abroad in defiance of war's gloom, 20 Years Ago LINDBERGS’ FLIGHT laid to anti-crime +axity,——_— RUSSIANS WARN Reich, Japs to watch stép. IF YOUD UKE SOME CANDY HELP YOURSELF AMFO C= Seams , a a er» omer LS a= Secu “Suggests That Child Drink Coffee When He’s Fully Grown—or 25 Years Old By WILLIAM BRADY, M. D. When should a growing child start drinking coffee for breakfast or any meal? (Mrs. L. J. M.) Answer—When the child is full grown—say the age of 25 years. Most people think we are crazy giving our children Grade A raw milk. If it’s crazy to have the healthiest children in the neighbor- ~ hood with exceptionally good teeth «.. (Mrs. W. D.) | Answer—Crazy as I am. Whereas previously my finger- nails were fragile and nil (from the standpoint of vanity) after a few weeks on a quart of A raw milk a day I'm booming in this department . . . (Mrs. W. H. G.) Answer—Minimum daily re- quirement of milk for child or adult is 1'; pints (three full glasses.) So you're doing well, for your nails, your hair, your complexion and your vite. Send | know for what ails Americans who do no honest work. Not only do I enjoy reading your column, but I have often used your sound advice for myself and for people in my care (R. N.) Answer — thank you—I won't tell on you, but if the little tin doctors heary about this they'll - censure you. ‘Enjoyed your ace for years. Don't ever change your style of , answering some of us nitwits who write to you. If you do we'll can- cel. (Mrs. B. A. R.) Answer—Thank you, Ma'am. And don’t worry. One doctor called it ringworm, another called it athlete’s foot. (L. A. K.) itch—all same. Send stamped, self-addressed envelope and ask for pamphlet on Foot Itch. ate . For months doctors have been - treating my husband's running ear, which they say is an infection pool. cea ony pestle cd ager nal ter make sure he consumes at . least a pint of fresh milk, skim milk or milk reconstituted (from Does leg ulcer ever heal com- pletely while one with varicose veins continues at work as mail carrier? (Mrs. N, C. B.) Answer—Yes, but a few days By following the instructions for ear irrigation and the facial ex- ercises given in your pamphlet I obtained complete relief from head noises and blocked ears, after all other treatment had been of no ae for over a year. (Mrs. R. W. W.) Answer—For the pamphiet on Tinnitus (Head Noises) and Deaf- ness send stamped, self-ad- Years ago-I discovered that an occasional application of borax— about a teaspoonful in a cup of water—to the armpits prevented excessive. or unpleasant sweating. Answer—Anyway it is harm- less. If it proves ineffective, send send stamped, self-addressed envelope for pamphiet on Excessive Sweating. ee coe letters, a certaie than one or treatment, carers ete Toe tine Press, Postice, . (Copyright 1985) | se R 24, 1955 THE PONTIAC PRESS. SATURDAY, DECEMBE | Christmas Thought: Serve God hildren > The Common Sund. UNITED LUTHERAN CHURCH OF THE ASCENSION Williams ané Lerraine Service 11:00 a.m. Confident Living: ; ‘Other Wise Man’ Shows Constant Search for Good By NORMAN VINCENT PEALE Most of us know the names of the three wise men who brought gifts | 7 P. M. Christmas PROVIDENCE Sunday School 9:30 A. M. 11 A, M. Church Service Program Choir and Sunday School Tuesday 8 P. M. Church Business Meeting Rev, T. Walter Harris; Pastor 311 Bagley Street |to an infant King in Bethlehem long ago. They have come down to us through the ages as Caspar, Melchior and Balthazzar. But not many of us know that there was a fourth wise. man — Artaban. Henry Van Dyke told his story beautifully in “The Story of the |. Other Wise Man,” and it is that story that I want to retell this Christmas. * * * * * * ~~ We know the gifts carried by the first three wise men — gold, frankincense and myrrh.: And what was the gift carried by Artaban? It was jewels—a sapphire, & ruby and a peari without price. He had sold his use and all his possessions so that he might buy these as his tribute to the newborn King. When Artaban saw the star, he knew he was des- tined to follow it. And he knew that elsewhere in the FIRST PRESBYTERIAN CHURCH William H. Marbach, Edward D. Auchard, Galen E. Hershey, Pastors 9:45 A.M. Church School 11:00 A.M. Morning Worship Sermon Topic: “Peace on Earth and In Our Hearts" Dr, Wm. H. Marbach, Preaching DR. PEALE East, there were other wise men like him who would | _Artaban was lighthearted and happy as he set out on his mission (of joy. His swift horse carried him quickly on his long journey ahd soon | he came close to the place where he expected to meet the others. But then, he saw something at the.side of the road, reined in his horse and dismounted, It was a man lying there, only half alive. Artaban was aj . skilled physician, but it took time to revive the man and help him. As|_ a result, he arrived too late to join the others and their caravan. He |had to sell his sapphire to buy a camel and equipment to carry him across the desert wastes. 4 FINALLY REACHES BETHLEHEM TOWN ll Al A i i i i i i i i i i i a a a i rrr VvVeV VV YS Dl lila ln i i i i i i i > a i Bn bth be le A i i i i i United Presbyterian Churches The Truth of God— Forbearance in Love OAKLAND AVENUE Oakland at Cadillac Theetore RK. Aliebach, Paster Bible School ..... 11:20 AM. Worship ....1000 A. M. “GOD'S UNSPEAKABLE GIFT Youth Fellowship .. 6:30 P. M. > Evening Service ..730P.M. ¢ Wed. Prayer 4 Meeting at ...... 7.30 P.M, 4 4 JOSLYN AVENUE Joslyn at Third Edmond |. Watkins, Paster Bible School ..... 930 A. M. Worship ......... 10:45 A. M Youth Fellowship . 6:30 P. M. Evening Service .. 7:30 P. M. Prayer and Study Session Thursday 7 P. eed we wnee . AUBURN HEIGHTS 3456 First Street 43. Barvey MeVann, Paster Bible ‘School ....10.00 A.M. Worship . ....... 11:1$ A.M. “IMMANUEL” At this service there will be a reception of Members and a Baptismal Service. DRAYTON PLAINS Walter J. Teeuwtssen, Jr., Paster 9:45 A.M. Bikle School 11:00 A. M.Worship Service Sermon Topic: “KEEPERS OF THE INN” No Evening Service i ; » “He Was Born i Man- eae wasiincton «Tee mumber/f Be Given by Choir | ser“ es Pons see ™ Lake and Gele Ras. Yict GI home loans guaranteed by |" Immediately following the serv- Rey F. Lambert, Paster \ rwwvwvwvvvVTVvVVUwvT TY —t—_——~—~—~—@wtwvervvvvvwvvvwvvwvvevvtrereeeT Finally, he reached Bethlehem and the house of a woman with a newborn infant. But this was not the King he sought. Yes, the woman told him, other wise men had been there already and seen another Child, but that Child and fts parents had left suddenly for Egypt. Dis- THE GOOD SHEPHERD — A picture called ‘‘The Good Shep- _ herd” was given to the Bloomfield Hospital by the Rebecca Circle of the Oakland Park Methodist Church. Mrs. John Fuller of Sheri- egg IES ATCT dan St., chairman of the Circle made the presentation to Clyde Marshbanks, administrator of the hospital. Standing beside him was Mrs. Earl Foster of Riviera Terrace, a nurse. ‘Come to the Manger’ to Be Sermon Subject The Evangel Temple will present a Christmas program Sunday at 7:30 p.m. in the Green Room of the YMCA building on Mt, Clem- ens St. A pageant, ‘Come to the Man- ger’ will be enacted with a group singing carols, The Rev, Geoffrey Day is the pastor. . Leake St. Church of God Charch School, 9:45 A. Morning Service, 11:00 A.M. Vv. P. Services, 6:30 P.M. Evening Service, 7:30 P.M. Rev. Paul Cooley, Paster, 68 Orten Pontiac Bible College Collier Rd. at Collier Court Interdenominationab - Classes fer Everyone 3 Evenings a Week Fer Information, Contact Rev, Frances £. Myer or Rev. nN. BK. Pawley jappointed and tired, he accepted the kind hospitality of the woman, And, while he was in her house, the soldiers of Herod knocked at the . s door, seeking the infants they were ordered to massacre. The ones COIL {0 Sing clutched her baby to her heart. Artaban went to the door and opened. it. The soldiers were about to push him aside and seize the infant when. he held up his precious ruby and said, ‘Take this and leave this house in peace.” Their greed overcame them and they reported no child in alo § un y that house. | Plans Tree Exchange The Sunday School of the First! Open Bible Church will present al Christmas program Sunday nem player and records Thursday as a gift from the employes of the Ab- ' First Open Bible Church |Firm’s Employes Present erect sed Record Player to Home The Oakland County Children's of gifts among themselves, the 96 Home was presented with a record employes donated $98 to purchase the player and records for the | | Title Guaranty Co., 18 » Ot. Instead of their annual exchange FIRST UNITED PENTECOSTAL CHURCH ef Pontiac ONENESS 324 -N. Perry St. SUNDAY SERVICES Listen to Sunda “When they saw the star, home. —they rejoiced” — —— Seema at 7 p.m. Aldersgate Fellowship to Meet Wednesday for Informal Fun From Bethlehem, Artaban went to the cities of Egypt, always | searching for the King apd always finding Him gone. He devoted his | life to the search. Somehow, something always happened to keep him | from reaching his goal. There was someone sick or helpless or afraid | whe needed him. He would stop to help and then have to begin all | ever again in his search. | Christmas morning, Dr. Milton Thus did thirty-three years of his life pass, and we finally find him) H. Bank will preach the sermon, old and worn and gray, but still searching for the King. The sapphire | “Love Came Down,” at the Cen- and the ruby had vanished long ago, but the pear! of great price has) tral Methodist Church at 10:45. been preserved all these years, the remaining gift for the King. Now) “per nis organ prelude, Robert he is in Jerusalem for Passover and people tell him about a man who is said to be ‘King of the Jews,” and is to be executed on the cross./ by Williams. ‘Pestiude” by Kern His heart deeply stirred, he realizes this is the King he has been seek-! will be played at the close of the ing for so long. The pearl may be enough to ransom Him. As he hurries | service. to Golgotha,-he passes a young girl being-carried- away into slavery) Mr. Stasiuk of Nelson St. is en- by soldiers. She throws herself at his feet and begs him to ransom her rolled in the music school in Ann and save her. He hesitates, and in an agony of decision he gives his| Arbor. He was a member of the freedom | Pontiac High School ir. eeert ee . “Come Now Ye Shepherds” by |SEARCHED FOR 33 YEARS |Elmore and “Glory to God in the As she clings to him in gratitude, there is a darkened sky and an/ Highest" by Pergolesi will be sung | earthquake. He is hurled to the ground by a stone and the girl kneels; by the choir with Mary Wignall labove him. Suddenly she hears a soft voice that is not his, but she can- | soloist. not discover its source. And then she hears the old man say: ‘‘No, my} G. Freeman Williams will be Lord. When did I do any of these things? When did I see thee hungry) —s 2 = cagijarlAmeatn —_ | and feed thee? When did I see thee naked and cigthe thee? When did sana entury Lullaby,” by Mc- I see thee in danger and save thee? For thirty-three years have I sought The white om = wit be - ‘ ” if ? | thee, but I have never found thee, my King. . tard lelpoy re =— Rebagh And then she hears that first voice again. This time it is sweet | Cnidren’s Village, Bronson Hos- and clear and, although she still cannot find the source, she under- | pital and- Chelsea Home. starids the words: “Verily I say unto thee, inasmuch as thou hast | 1. Aldersgate Fellowship, all done it unto one of the least of these my brethren, thou hast done it college students, service men and unto me.” . ; women and all of Central's older — ‘| youth are invited to the home of The girl looks down at Artaban and sees his eyes neers tor tne as Dr. and Mra. Burk, 88 Frankia time and a smile of peace cross his lips. The fourth wise Boulevard, Wednesday evening at brought his gift to the King. 7:30. This is an informal get to- * ¢ * |gether for fun and fellowship: It is the old, old story that has moved tie hearts of men through | : the ages, that we serve God by loving his children. By helping them, we help Him, and thus the peace of God fills our hearts. | €op @ 0 an Now it is Christmas again and the message of the King rings loud | | and clear through the world: “Inasmuch as thou hast done it unto Greek, English , one of the least of these my brethren, thou hast done it unto me.” Life's ‘fullest happiness is realized only when that happiness i ) | Bishop of Pittsburgh. to Visit Local Church shared with others. : New Year's Day * Ld * * * * MERRY CHRISTMAS — and God bless us, every one. (Copyright 1955) ‘Child of Bethlehem’ | cirismas morng, the Rev | Soterios D. Gouvellis wil give the VA Home Loans to Gis . Hit Peak in November “The Child of Bethlehem” will be given by the choir of the Memo- ice, carols will be chanted in Greek Administra‘ in the Veterans tion and Engtish. November reached a new high for > Bible School 9:30 A.M. ¢ rial Baptist Church, 351 Prospect} The Bishop of Pittsburgh who is zootre ~ . .. g{the second consecutive month. i ; Morning Worship " 10:45 A. M. 4 VA said today it guaranteed 66,- St., Sunday at 7:30 p.m. . the head of the Church in this SA Soruu 8:00 P. M. 4/400 loans totaling more. than 755| The following selections will be — ve Nbape the local parish on dult Forum ...... ‘00 P. M. x ; ew Year's Day. D Youth Fellowship .. 7:00 P.M. g/million dollars last aoe ee Choir! Bishop Polyeftektos Finfinis was 4 3 cent increase over|T > heipara hdl a ead On Thee We Wait, bass solo, Brown eleva he Bishoptry 4' October. Holy Night.......+...... jomen's Chorus| recently ted to t ’ = . There y Ghepherds......... 2... by the Archbishop Michael upon Giory ‘song. 2. en ® Chorus SPO he sanction of the Orthodox ; ’ Ge Marjorie Robertson | Church, Patriarch Constanti- All Saints Episcopal Chu Ber Unto Bethebes oo caus ie [nople, Athenasoree the Piet Williams Street at West Pike | Star in the Bastern Sky ““Biann‘iepers|__1m the words of the Orthodox Bez. Gemma, WORN, Roster } Who is He... Piten’s Chorus, = Church, the people wish all a “Kala CHRISTMAS EVE Fae ed eel 4:00 P. M.—Famtly Worship Service Thy Light Is Come.............. Arior An atomic beam chamber marks “ts , | Let Us Adore in niente. a clock built for England's Na- 11:00 P. M.—Choral Eucharist and Sermon by the Rector ~— CHRISTMAS DAY | tion 8:00 A. M.—Holy Commanton will be piano accompanist. ten-thousandth of a second. ‘11:00 A. M.—Choral Eucharist and Traditiona! j x "Chorals by the Sentor Chotr Ins —s - ST, GEORGE'S CHAPEL FAITH BAPTIST CHURCH rica ttt: eons $460 Williarns Lake Road! (CAI Building) " CHRISTMAS EVE : , ~ oe : me pet aren to den en * 00 P.M. Rucharist a oP, 11:00. m. hip ; Tapio: Bickley, Vicar % Rev. aoe Gee : "Ne Room For Jesus” - Day Gareth, Communion 1:30 p.m. Colored Film: Nativity Scene. 1100 a Beny Communton The .cantata is under the direc- of William Meyers, Pat Brown tional Physical Laboratory ‘which is able to keep time to within a 1 Wy Stasiuk will play “Rhosymedre” | This will be followed by an old| fashioned Christmas tree exchange| |of gifts. The affair will also be a |homecoming for a former pastor jand his family, The Rev. Fred | Peter who-has a pastorate in At- lantic, lowa. Mr. and Mrs. Welden Davis are home for Christmas from Des Moines, Iowa where they have been will be at the program. The church is located on block north of E. Walton Blvd. on Joslyn Rd. Funds |Housing Administration says it has the money for local housing of- ficials to plan 100 low-rent homes jin River Rouge, Mich. The money is for, the plans and preliminary surveys only, not for construction. |attending Open Bible Institute and| for River Rouge WASHINGTON W—The Public’ Eve. Please Come WEEK LONG CELEBRATION CHRISTMAS EVE TO NEW YEARS NIGHT 7:30 P.M. NIGHTLY A great Service is Planned for New Years and Watch the Old Year Out and the New Year in with us! for you we have s message of restoration Isaiah 1-18. “Come now let us reason together.” L. A. Parent. Paster PASTORS. ELDERS, DEACONS AND MEMBERS “extend a hearty Welcome to™ anyone who has ever attended our church and to everyone who has a Gpiritual need and has not yet found our church : . to visit with us this Christmas Week. To those who feel they have failed, and de- sire the joy they once knew, Come and let us help you. L. A. Parent, Pastor PASTOR and PEOPLE of THE Evangelistic Tabernacle 60 Tilden at W. Huren Wish You a Merry Christmas and a Christmas Services 6:30 and 7:30 P. M. Happy New Year Attend Inspiring 10:00 and 11:00 A. M. Watch-Nife Services, Dec: 31, 8:00 P. M. Attend REY. A. J. BAUGHEY, Paster SUNDAY, DEC. 25 10:00 A.M. to 11:15 A.M. ONE GREAT SERVICE — INSTEAD OF TWO BROADCAST 10:05 - 11:00 A. M. OVER WCAR “THE VIRGIN-BORN CHRIST” DR, TOM MALONE, Speaking Gospelaires Quartet—Emmanuel Tabernacle Choir 7:30 P.M. THE ANNUAL CHRISTMAS CHORAL PAGEANT One Presentation Only “BORN TO DIE”. Colorful Pageantry. Inspiring Music Participating Cast of Over 150 EMMANUEL TABERNACLE CHOIR Choral Director—Mrs. Tom Malone EMMANUEL CHRISTIAN SCHOOL MIDWESTERN BAPTIST SEMINARY PAGEANT DIRECTOR, Fleyé Osburn ltl i] 8:30 p,m. Carols. Singspiration. Ve a ‘ EMMANUEL BAPTIST CHURCH ORCHARD LAKE AVE. AT TELEGRAPH ROAD Rev. Tom Malone, Pastor , 'O rte eee Youth F ellowship Holds Christmas Rally Tonight The Christmas Youth Rally, sponsored by the Oakland County Youth Fellowship, will be held to- night at 7:30 p.m. in the Perry! Park Baptist Church, Cameron and Baltimore Sta * * Featured on the program will be trumpeter, Jim Steenson. He will be accompanied on the piano by his mother, Mrs. E. S. Steenson. Speaking at the Rally will be the Rev. E. S. Steenson of West Bloomfield Baptist Church, * * * The Rally will conclude at 8:30 with giving Christmas candy. Film to Be Featured — “Born in a Manger’ will be; shown Sunday at 7:30 p.m. in the Liberty Baptist Church, 250 Fisher St. Mrs. Maggie Baldry and Mrs. Emma Kindace are in charge of the program. The Rev. S. M. Ed- wards, pastor of the church, will bring a short message. MOUNT OLIVE GENERAL BAPTIST CHURCH 98 West Howard St. woe Sunday School * 10:00 A.M. Morning Service 11:08 A. M. 1:80 P.M a ecm, Prayer Service ieee | Wed, 1:30 P.M. CECIL KELLER, 6.8. Supt, The Rev, &. L. Beck, Paster tonight at 11 o'clock. Phillip Stei CHRISTMASTIDE SERVICE — Church will sing at the Choral Eucharist Christmas Eve Service (extreme left), announces the following selections: The choir of All Saints Episcopal nhaus, choir director and organist “Te Deum" play a French Carol, ‘Noel Sur Les Flutes” by d'Aquin and “Finale” from the First Symphony will be the Postlude. Holy Communion will be celebrated at 8 o’clock Christmas morning. In place of a sermon at 11 a.m., the choir will present a program of traditional carols— by Everett Titcomb, ‘Merbecke” during Communion, and “‘O Mag- num Mysterium” by Vittoria. For his Prelude, Mr. Steinhaus will Highland Congestion 13th century French carol and two carols by the “Star Carol.” Mr. Burt grew up in Pontiak. Bates Burt, was the rector of All Saints Church 25 years. The “Lo How a Rose,” a German carol, ‘‘So Blest a Sight’ an English congregation will join the choir in singing the familiar Christmas |~ , carol written before 1536, ‘“‘Here ‘Mid the Ass and Oxen Mild,” a carols. “Carol of the Birds,” a Spanish carol late Alfred S. Burt, Baskets of Food Given to Needy New Associate Pastor to Preach Christmas Morning at 9:45 Christmas will be onserved with services at 9:45 and 11 a.m. Christ- mas morning at First Presbyterian Church. The Rev. Galen E. Hersh- ey, new associate pastor, will con- duct his first service at 9:45 a.m. Dr. William H. Marbach will preach at 11 o'clock on the theme, “Peace on Earth and in Our Hearts.” The choir, under the direction of Lyndon Salathiel, will present Cesar Franck's anthem, “The One Hundred Fiftieth Psalm.” Mrs. John B. ‘Nicoll Jr. will sing the offertory solo, “Christmas Eve” by Hageman. The Deacons of First Presby- terian Church, under the direction of the president, Miss Florence Day, have distributed plants to over 40 sick and shut-in members of the congregation. White gifts presented by the Church School children were in- cluded in baskets of food which were distributed to needy families. Gene Pattison, a candidate for the Christian ministry, accom- panied by Rev. Edward D. Au- chard and Rev. Galen E. Hersh- ey, will attend the Celtic Crosse Service of Detroit Presbytery at First Presbyterian Church, De- + troit, , Dec. 77. The Celtic Cross is the Presby- terian fellowship for those inter- ested in church vocations as min- jisters, missionaries, directors of Christian education, and workers in other related fields. St. Trinity Pontiac Press Photo “Jesu Parvule”’ and | His fathers-tt® Rev. | % Block off M-30 en Milferd Ra. A four-pound prehistoric mam- pats eee a cor i) Ole erman's net at Southwold land. FIRST CONGREGATIONAL CHURCH Corner Hast Moron ond Mt. Clemens ot Mill St, Pontiac Sarton, ieiais Malcolm g.B Morning Service, 10:30 A. M. “GLORY TO GOD” The Rev. Mr. Burton, Preaching | St. Trinity Lutheran School will |present its annua! Christmas Eve | Children’s Service in the church at It: 30 tonight. Hymns and carols will be sung lby the congregation. The children |will offer the following program: AT CHRISTMAS TIME ¢ We pause to acknowledge and thank all of you for the Church activities and May God Bless you and yours with Health and Happiness. Apostolic _ Church of Christ BISHOP PARENT, Paster [South Side Church of God | WHAT CHRISTMAS MEANS— | Janice Fralic, Kenneth Walter, | Evelyn Mar, Jim Roy McDaniel, | Linda Pankey, Dennis Miller, Bible School F Program Scheduled for 9:45 A.M. All of the children of First Chris- tian Church are invited to share in the Bible School program which will begin fifteen minutes. early, at 9:45 a.m. The program will include group isinging, recitations, and a visit \from Santa Claus, This period |will be held in the church base- ment, The worship service will be held in the sanctuary at 11:00 a.m.| St. Trinity Lutheran School “to Have Annual Yule Rite Joan Drake, Michael Jansen, Joan Coyle, Jeanne Barnhart and Helen Jean Eng. CHRISTMAS COMES WITH JOY AND CHEER—James Beck, Bruce Bonham, Darcy,Gonzales, Ronald Smades, Daniel Durman, Carol Smith and Edward Benns. * * * CHRISTMAS CANDLES — Paul Irish, David Beck, Shannon Henry. Barbara Kimmel, Larry Kasat and Gonzales, Michael Scribner, Rob- ert Walter, Robert Reiter, Taun- ya Negus, Julia Claus, Richard Reiter, Sherry Bonham, Gary Course, Linda Smades, Mark Pa- pazian, Cari Paulson, Mary Jane Baldwin and Janet Baker. THE SAVIOR’S WONDERFUL BIRTH — Steven Barron, Pamela "|Barron, Margaret Beck, Carol |Kresge, Betty Jean Fralic, Donna MOTOR oanéd NEBRASKA STS. — Geboo! at 9:45 Brown, Joyce Brown, Enid Mar, |Engla Nocella and Gayle Reas. | THE CHRISTMAS STORY—Don Durnen, Arthur Saunders Jr., Ger- lald Strebe, Joel Smith and David StohIman. ANNOUNCEMENT TO THE praise, With hearts so light and free, We sing of Him who bro't us life And taught us charity. iour, who is Christ the Lord.” Singing of the Traditional Christmas Carols. by the Junior and Senior Choirs Message: “The First Day of Chri stmas” Sunday School 9:45 A. M. Morning At Christmas time we sing in ANONYMOUS “For there is born to you this day in the city of David, A Sav- May He, whose birth we celebrate at Christmas, grant to you His loving Bene- diction and a Blessed Christmastide. We cordially invite you to worship with us at these Christmas services. TONIGHT, Christmas Eve, 11 P.M. FESTIVE MIDNIGHT CAROL SERVICE Special Music SUNDAY, DECEMBER 25th, (Christmas Day) “O come, let us adore Him, om the Lord” ST. JOHN'S LUTHERAN CHURCH (National Lutheran Council) 87 Hill St. at Cherry Court Worship 11:00 A. M. SHEPHERDS — Andrew Helle, Howard Kresge, Alice Reiter, | Rosemary Mitchell, Michael Hub. _bard,_Derothy Waidelich, Paul | Perry, John Helle and Roger THE SAVIOR'S GOSPEL—Mar- jorie Whitten, Nancy Partin, Flaine Mar, Arlene Brown, Edward Perry, | Svenn Helle and Stephen Stohl- mann. 4 Young People Plan Program ‘A Boy and His Bible’ to Be Presented Sunday by Fellowship Groups The Pioneers’ and Builders’) Youth Fellowship groups of the Oakland Avenue United Presby-|M ae iterian Church will conduct the eve-| ie Miller and His Bible.” The film presents e story of a! cynical newspaper editor known! for his fighting editorials and a new copy boy hired for the Christ- mas rush. The editor is having trouble meeting the deadline for his Christ- mas editorial and suggests to the copy boy that the Bible ought to have something fo say about Christmas. The boy comes to his assistance, in many ways. The editorial is Servi written and receives a great deal! of favorable comment” The editor eoncludes that what is in our hearts must be changed to solve the confusion of the world, and that the Babe of Beth- lehem is the only one who can do that. The pastor, the Rev. Theodore ’ R. Allebach, will use as his theme ‘for the 10 A. M. message, ‘“‘“GOD’S UNSPEAKABLE GIFT.” Sunday Services Christmas Day Services at Grace HASTEN MORTALS, TO ADORE Lutheran Church will be held at HIM—Judy Perry, Sharon Wolter,9 and 11 a.m, Sunday School will and Donna Whitcomb. Carols will/be as usual, during the two serv- also-be sung by the children. ices. Lutheran Church ‘Why Christmas?” | Is Subject of Sunday Playlet | “Why Christmas?” will be the, Christmas playlet to be presented EVANGEL TEMPLE Y. M. C. A. Side Entrance Non-Denominational aerate Lop Sunday Series Warship, 11:60 A. La 3 ngeltatto Service he venting, ce —— Geolfrey Day. B.A.B.TH. Pastor Aubern Ave. at Jesiya Missouri Synod Rev. Ralph C. Claus SUNDAY SCHOOL 9:45 A. M Yet SERVICE 8:30 A. M. 2nd SERVICE 11:00 A. M. at the Marimont Baptist Church Sunday evening, beginning at 7:30 o'clock. The Willing Workers Sunday School Class will present this play; | the cast to include: ’ Old MAN ... ceceseewseeses Jack Ryder, Mr. Jones Robert Gavette’ |Mre Jones Mrs. Helen Vaught | Miller Clare Titsworth | ‘ Billy WATERFORD COMMUNITY CHURCH Andersonville Road, Near laa Highway Sunday School, 9:45 A.M. Service 11 A. M. Christmas De Deeetions 78 . M. Christmas Greetings to Everyone Holiday Musicale Wed., Dec. 28, 7:30 P. M. Rev. W. Van Plew, Pastor Undenomiacational . Gerald Titeworth Cathy Chandler, Betty cee eee Pear!) Griffith Jack Gordon Matthews’ A “Unified Service’ will be held | in the morning as the Sunday School combines with the Morning, Worship for a 10:3)-12:00 Christ- mas Day Worship. Rev. David Mortensen, pastor, will speak upon the theme, “= We Join the Wisemen?” A special “Gift to the King"’ of-| a will be presented in this Junior Jones ... Marie ing service at 7:30 Christmas yeney 0 Carol Barron. Dey. . Mreamith eaere O. Taber | = THE SAVIOR'S WONDERFUL ‘ . wit ‘Peep ee eenae, Tener 2 ‘Carol Sing” precede | edna eee seees seer secs 10 Eee ay oan tate Linde = showing sae fim, “A Boy [Mr Peterson 2.2... Sirs | Johnson, Betty Perry, Nicholas Mrs. Peterson .. Mrs. Jack Ryder ; The SALVAT ION ARMY SUNDAY SCHOOL ........... cows s 8245 AML HOLINESS MEETING ............... .... TD AM, YOUTH SERVICE ............. weeeeese 6 PLM. EVANGELISTIC MEETING .............. 7:30 P.M. S/CAPT. and MRS. MAGNUS Thursday Prayer MICHALSEN, in Charge | 7:30 P.M. 29 W. Lawrence Street The a aakdren will place their mis- jonary Christmas offering as they haag their stockings on the Fire) Place and the adults will bring, their offering to the Christmas Treasure Chest. The public is cordially invited to both services. CHURCH OF CHRIST Meets af 1196 Joslyn Ave. fer Worship EACH LORD'S DAY MORN, 11 A. M. Services Each Lord’s Day Evening .......... 7:00 P.M. Matt. 16:18 And 1 say unto thee thou art Peter and upon this rock I will build my ghurch. And the gates of hell shall not prevail ageinst it. fog teem Me ee) EO oe FE 17-0226 "Gloria Excelsis’ ito Be Sung Sunday 4 The combined choirs of the New-| man A.M.E. Church, 14 Auburn FIRST CHURCH OF GOD 25 East Boulevard — Seuth of Lockout Drive 9:45a.m. Sunday School 10:45 a.m. Morning Service 7:30 p.m: Evening Service For Transportation Call FE 5-7768 or FE 4-1782 M. Eugene Rameey, Minister — Gen. Offices: Andersen, ind, Ave., will present the cantata, “Gloria Excelsis’’ Sunday during the morning worship service at 11. Mrs. Annie Mae Murray will di- rect the choirs assisted by Gladys (Classes for Oakland ‘and Saginaw, Pontiac, Michigan Rev. H. H. Savage, Pastor iE... Rev. W. E. Hakes, Ass't Pastor : Our responsibility—the World; Our resou the Word, © MORNING WORSHIP—10:45 A. M. “Merry Christmas and a Happy New Year! How?” EVENING SERVICE—7:60 P. M. “Unfamiliar Characters in ute cue dng I Peter 2:24 SUNDAY SCHOOL—9:45 A. M. All Ages) WHICH TREE? - Tinseled trees symbolize the warmth of the Christmas season. But the cross of Christ brings lasting purpose and_ satisfaction. “Who His own self bare our sins in His own body on the tree, that we, being dead to sin, should live unto righteousness.” program |} and tree is planned for 7:30 Sunday jevening. Mrs. Grady E. McFee, superintendent of the Sunday School, will be in charge. The Rev. |f J, Allen Parker is pastor of the) church. 306 Midwa one Sanford School ...10 A. M. Sunday Young People . 6:45 P_ M. Eve. Worship .. Erde P.M Divine Healing Service Wednesday, Day of Prayer, at 10 A.M. Study of “Book of Revelations eee Thursday, Communion oa ere 7:90 P.M, Rev Rose L. Davis, Pastor Rev. Daniel Revese: ee Pastor Morn. Worship ...11 A. M. vo LL ALM, | Junior Church PE 49652 | An American Universal Ave., THE CRESCENT HILLS BAPTIST CHURCH William E. Goding, Pastor Church, located on Crescent Lake Road at "Watertond Township, to serve the entire community. Sunday School 9:45 A. M. Worship of Ged 10:45 A, M. All Are Welcome! | The Christian and Missionary Alliance Church 178 Green Street “+ (Near Orchard Lake Ave.) Sunday Scheol 9:45 A. M. Sunday Worship 11:06 A. M. FIRST SOCIAL BRETHREN CHURCH 316 Baldwin Avenue a Rev. Tommy Guest PE 2-0304 Sat Evening Service........ saves soeagslcll 00 Sunday School ....... ci Tee Gy Service oi... i ceseseeseeeees A100 AM, Prayer Service Thurs. ..........--:..... 7007. M. © Public Invited “PROPHECY FULFILLED AT CHRIST'S BIRTH” . Evening Service 7:30 P. M. “CHRIST—CHRISTMAS AND CONVICTION” ' Rev, G. 5. Bersche, Paster Service wove ect t 00 Praise nag § ¥, * eeeeeeee aa ‘ane Wednesday, 7:30 Sundey School ....... 9:45 BEULAH HOLINESS C Qumun and Going Streets IRCH | CHRISTIAN PHYSIC H. JOUN DRAKE, Paster Sunday Service, 7:30 P.M. 2 i | as ee ee ee First Open | Emmanuel Christian Schoo! will : participate. program en Bible Church “Born to Die’ will be developed Rev. T. H. Staten FE 2-8497 Church Scheel 10 A.M. Morning Worship 11:30 A.M. Youth Service 7:45 P.M. : Evangelistic Service 7:45 P.M. Wednesdey Prayer | Mrs. Joyce Malone and Floyd bed nt LE [Osborn will stage the play. The Build your | public is invited, home with us on the Open Bible Emmanuel Baptist fo Present Pageant Mr. Drake, speaker The Emmanuel Baptist Church Silver Tea, Wed., 7:30 F. M. [will present its annual Christmas \Pageant Sunday at 7:30 p.m. A cast of 50 people, the church choir and the glee club from the iby a series of readings, solos and trios. It will be highlighted by a pantomime with special staging) and lighting. Musie ig under the direction of Air, service between Rangoon, Burma, and_Madras, India, is un- der discussion. . — 9:45 — Sunday School “CHRISTMAS LESSON” 11:00—Morning Worship “THE KINGS’S 7:00 —Evenin Service $:00-9:00—Young People Go Caroling FIRST UNITED MISSIONARY CHURCH _135 Prospect St., Geo. D. Murphy, Paster \ ~ ‘ : $ iN __ id ~ BETHANY BAPTI ST CHURCH W. HURON at MARK THE ANNUAL CHRISTMAS FESTIVAL SERVICE SUNDAY AT 11:00 A.M. Choirs, Soloists, Orgen, Chimes, Home Consecration, Baby Dedications—The Ordinance of Baptism. SERMON—*“There's a Baby on Your Door Step” © FRED ROBERT TIFFANY. Preaching Welcome To Ali Sunday School 9:45 | tised Michael Gene Stoutenburg, one month old, at a recent Service | of Holy Baptism in the First Presbyterian Church. The baby is the HOLY BAPTISM — “For unto us a child is born, unto us a son ‘again will si | iS given.” Dr. William H. Marbach was photographed as he bap- infant son of Mr. and Mrs. William E. Stoutenbur? of Gateway “cn at avenue. Dr. Marbach has been pastor of the First Presbyterian | 4 Church of the Lutheran Hour. for nearly 25 years. _ Christmas Eve Service Tonight Junior, Senior Choirs to Sing for Traditional Children’s Program The traditional Children’s Christ- jmas Eve Service will be held again ‘this year at St. Paul Lutheran Church, Joslyn at Fourth streets. The service will begin tonight at T p.m. with the entire Sunday ischool and choirs participating. Theme for the program is ‘“O iHoly Night.’’ Opening the service jwill be Pastor George Mahder with +a tatk on “O Hoty Night**— | * « 6 | The junior and senior choirs of the church will sing several Christ- imas selections throughout the pro- gram. | Directing the program will be ‘Emil Hagen, with Roy Linkswiler assisting, while the choirs are un- ider the direction of Mrs. Emil }Hagen and Paul L. McMichael. | Christmas Sunday services will ibe held at the usual time, beginning lat 10:45 a. m. Sunday School pre- | cedes this at 9:30 a.m. The sermon topic for the occasion will be ‘‘The Greatest News Report.”” For the Yontuse rress rhote iChristmas: Day service the choirs ‘and TV's “This Is the Life,’ St. t Spellman Arrives in Korea to Sing Mass for Troops WESTERN FRONT, Korea. (Ph — Francis Cardinal Spellman, Roman Catholic archbishop of New York, arrived by helicopter today to celebrate Christmas Eve mass for American soldiers 10 miles =—|{rom the Korean truce line. - “Pontiac's Singing Church” KENNETH A. HUTCHINSON Minister ARTHUR HUBBS Minister ef Music 10 A.M. A CHRISTMAS MESSAGE 7:30 P. M. CANDLELIGHT COMMUNION RVICE SE Church Scheol, 9:45 A. M. Youth Service, 6:30 P. M. The cardinal stepped from the helicopter into the cold mist of a frosty afternoon after flying over the snow-powdered hills from Po- hang in the south to spend his ‘the Gls. He was welcomed by Maj. Gen. S. B. Mason, commander of the ‘S. 24th Infantry Division, and ‘proceeded to 19%h Regiment head- quarters where he will celebrate mass. At Pohang the cardinal left a donation for the Little Flower Or- phanage which cares for 230 Ko- rean children and which has been bmopee by U.S. Marines since Ol. “We Offer You Christian Fellowship” Central Christian Church 347 North Saginaw Street CHAS.-BD. RACE, Paster—FE 4-0239 _ @unday Gervice: Bible School, 10:00 A.M Service, 11:00 A.M. “FOR UNTO YOU A SAVIOUR” Evening. 7:30 P.M. Colored Christmas Monday, 7:00 P.M. Youth Meeting Pictures Wed., 7:30 P.M. Prayer and Leaders’ Training Class ‘Christmas Promise’ fo Be Sermon Topic “Christmas Promise” will be the heme of the Rev. James W. |Deeg's sermon Sunday at 10 a.m jat the Oakland Park Methodist | Church. | Tuesday evening, the Youth Fel- FIRST METHODIST S. Saginaw at Judson St. Rev. Paul R. Havens, Minister NO oe Morning Service “A BIRTH IN BETHLEHEM” Broadcast on WPON 10:15 A. M. No Youth Fellowship 7:90 P.M. 6... cece ee Sound Film lowship group will entertain a group of teenage youth from the |St. Luke’s Methodist Church in De- troit. Each young person will be pre- \sented a Bible. Last summer the } church group sent two of the De- | troit youth to camp as part of the ‘Fall Action Project.” | After an evening of games and Candlelight choo brady Service Slated vee umecn : McAuley School of Practical Nurs- Choirs of Trinity Baptist ing received their caps last night School Graduates 59 Foreign Students at MSU 28 cordial welcome to. their to Enjoy American Yule EAST LANSING u — An Ameri-’ can Christmas, with extra features, Fifty-nine student nurses of the will be enjoyed in this area tonight by 73 foreign students from countries. \Paul Lutheran Church extends to _ FIRST SPIRITUALIST CHURCH 16 Chase Street No Services Christmas Sunday Midweek Services Wed., 7:30 P.M, Regular Church Services Resume Sunday, Jan. ist. A FIRST ASSEMBLY OF GOD 210 N. Perry St., Pontiac REV. W C. WIBLEY, Paster en 4 tw Pe Ge gs Sunday School ............ 9:45 A Treat for All the Children Worship 11:00 o'Clock S. 8S. Chrismtas Program Sunday Evening 7:45 Christmas in Music MID-WEEK TUES. - THURS. 7:45 P.M. WPON — Sunday 8:00 to 8:30 A.M. “Visit the Church of the Old Fashioned Gospel!” Parkdale Church = 9:45 A. M—SUNDAY SCHOOL of The Nazarene Join in Early Christmas Morning Program All choirs of Trinity Baptist Church will join in the Christmas Candle-light Service Sunday morn- ing at 6 o'clock. The Rev. Richard H. Dixon Jr., Christmas message, ‘‘God's Christ- ‘mas Gift to Man.” At 7 a.m., the Men's Club will serve Christmas breakfast in the church dining room. Vernon Page is president of the club. The Adult Choir and Men's Cho- rus will furnish special music for ‘in a ceremony held at the school. The students, gathered from 40. The awarding of the caps cli- Campuses in the nation, are par-| maxed a 13-week foundation period ticipating in the third annual Michi- | ‘during which the students partici. 84” State University ‘Christmas pated in classroom discussion and Adventure in World Understand- istudy, Ing. | The caps were awarded by the In addition to spending a night at Rev, Father R. Burroughs of De-the home of business, industry and ‘troit. Nursing practice in hospital !abor leaders for Christmas Eve fifth consecutive Christmas among Pastor of the church, will give the experience was givén at St. Joseph dinner and church services, the = students toured a local factory, \Visited with officers of the United ot? rr ‘Auto Workers Union. Civic Club Fetes 7 : Underprivileged | - ‘or tue oxrrmein Mercy Hospital. OF THE BRETHREN 46 N. ROSELAWN Area Youngsters Sunday Scheel, 10:00 A. M. Merning Christmas Message, 11:00 10:45 A. M.—CHRISTMAS SERMON: “WE HAVE SEEN HIS STAR” 7:00 P. M. CANDLELIGHT SERVICE Parkdale and Hollywood. Wayne E. Welton, Minister Block W. of Baldwin Ph. 2-6928 | A Joyous — Christmas to You! | in the Wishiof | The Pilgrim Holiness Church the morning worship at 11 o'clock. : “What's — artemis will be the’ The Pontiac Exchange Club topic of the Rev. Mr. Dixon's ser- ™de Christmas seem considerably Evening Service, 1:00 P. M. at 81.8 Paddeck LEROY “SHAFER, Paster Prayer and Bible Study, 1:30 P.M Baldwin and Fairmount YOU SHOULD BRING YOUR FAMILY TO mon. At 7:30 p.m., the Senior Choir ‘will present ‘The Messiah” under the direction of Levi Eubanks. Soloists will be Mrs. Louella Fultz and Mrs. Margaret Overton, so- prano; Mrs. Charles Collins, alto; |Fred Edwards, tenor, and Charles Twitty, bass. | Mrs. Sarah Lawrence will be playing the organ and Eugene Rush will be at the piano. Christmas Festival Service Scheduled The annual Christmas Festival | Service of Bethany Baptist Church |is scheduled for tomorrow morning ‘at 11 o'clock. The Altar Consecration Rites for infants will be in this service as will the dedication of the homes of 'the parish. . | Jean Hilton will be soprano solo- brighter yesterday for 25 under- privileged children from the Pon- tiac area. Members of the club picked the children up, brought them to their annual Christmas party at the Wal- dron Hotel and watched them en- joy a meal at the expense of the club. Santa presented a gift, which each Exchange Club member pur- chased, to each boy and girl at the party. The children, along with some member's children, sang Christ- Prayer Meeting, Wed. at 1:30 jmas carols along with the mem- Rev. —s — Pastor ibers. Some magic tricks also were. = displayed at the event. , ee eee ee — CHRISTIAN SCIENCE — SUBJECT FOR SUNDAY “CHRISTIAN SCIENCE” PERRY PARK BAPTIST CHURCH Baltimore and Cameron Opp. Emerson School SERVICES Sat. Night Dec 24 Youth Rally-—7:30 PM Sunday Scheel, 16 A M Meoraing Worship. 11 A.M. Yeeth & Children's Church, 1! A. M. Sunday Evening. Dec 25 Combined Service 7 P.M. ‘Sound Motion Picture) “That They May Live™ Sunday Services and Reading Room Sunday School 11 AM. \s |= } Central Methodist CHURCH ON CHRISTMAS MORNING Sunday School (all ages)..............10:00 A. M. Worship .... 0.6.6... eee ee. 11:00 A. M, Pilgrim Y. P. S........... Soe Gosoeu a boc 6:45 P. M. Evening Service ......... . 7:30 P.M. Come — Let Us Worship The Christ of Christmas The Little CHURCH with the BIG HEART E. C. SWANSON, Minister ROY OVERBAUGH, 8. 8. Supt. % EAST HURON at PERRY Rev. Milten 8. Bank, D. D, Minister Rev. John W. Mulder, Asse. Minister December 24, 10:45 P. M.—Christmas Eve Candle-Light Communion Service Sunday Morning 10:45 A. M. “Love Came Down” | (Broadcast ever WPON 11:00 A. M.) Dr. Milton H. Bank, Preaching |fellowship, a brief service of wor-| ist with the choir. The Rev. Fred iship will be held in the sanctuary.| R. Tiffany will speak on “A Baby m Wednesday Evening Service, 8 P. M. } | 2 East Lawrence Street | Open Daily 1] A. M. to 5 P. M. Friday to 9 P. M. | “A BOY AND HIS BIBLE” Wed. Prayer Meeting and Bible Study Rev. Paul Havens Specker Song Leader: Mr, Wm. Farrell UNITY _ Tits N. Saginaw St. ] Sunday 11:00 A. M. Kenneth Brabeau, Speaker You are Cordially Invited to Attend: Christmas Eve Services... w Christmas Day Setvices.........10:45 A.M. | | * Christmas Sunday School. oe. -7:00 P.M. ....... 9:30 ALM. w St. Paul Lutheran Church Joslyn at Fourth, Pontiac Rev. Geo Mahder CHURCH of the GOOD SAMARITAN Wishes Everyone the Season's Greeting Ne Service Deo, 25 Silver Tea, Tuesday, Dee. 27 Services as Usual, Jan. Ist | tm on Your Doorstep.” The progra: | will close with the Baptism of girls ‘ari women. A Baptismal Service for men and boys will be Jan. 1 FIRST CHURCH OF CHRIST, SCIENTIST Lawrence and Williams Streets during the Communion Service, Sunday School will be at 9:45 al “THE MEA with one worship service at 11 a.m. Toerr Salvation Army Will Get | NING OF CHRISTMAS” Station CKLW—800 Ke Sunday 9:45 A. M. I ee Set Bentley's $10,000 Boost | OWOSSO W—The Owosso Sal-| ATTEND CHRISTMAS SERVICES t vation Army building fund is going ito get the $10,000 increase in Rep. Bentley's congressional pay this year. | The millionaire Republican pre- viously pledged a similar amount from his 1956 salary to a Saginaw Rev. Cawsey, Lake Orion, Speaker 19 Aubern Ave. DAV Hall YMCA building drive, WESLEYAN 67 NORZH LYNN STREET 10:00 Sunday School 11:00 Worship Rev. C. D. Friess, Pastor METHODIST W.Y. P. S. 6:45 P.M. Evangelistic 7:30 P.M. ee “HIS NAME SHALL BE A . Full Gospel—Nond ii 9:45 A. M. Morning Worship Rev. Robert C. Laird, Speaker “NO ROOM IN THE INN” 7:45 P. M. — Christmas Cantata by Choir Come and Worship with Us Morning Worship. coasstl 8.T.U. , i i ee a | REV. A. H. MULLINS, Paster First Southern Missionary BAPTIST CHURCH ¢ 365 East Wilson Ave. ti] Sunday Schoot >... . 9:45 A. M. cess. 6:45 PLM. of Evening Worship ...... 7:30 P.M. Wed. Prayer Meeting .. 7:30 P.M. Young People’s Bible Stu. 8:00 P.M. | Allilicted With Southern Baptist Convention 200 A.M, Phone FE 4-8574' CHURCH OF CHRIST 1180 N. Perry — Phone FE 2-629 MILTON E. TRUEX, Minister “THE HERALD OF TRUTH” 7:38 P.M. Wednesday Eve. Service WXYZ—Each Sun. 1:00 te 1:30 F.M. 9:50 A.M. Sunday Bible Scheel 7:28 P.M, Sunday Evening Service 10:50 A.M, Sunday Worship FE 5-7642 871 Rebinweed Ave. ]| GRACE LUTHERAN CHURCH ~ 114 S. GENESEE ST., PONTIAC Candle-Lighting and Carols Tonight at 8:00 P. M. cme First General Baptist Church Sat. Evening Service... 7 P. M. Sun. School ..10:00 Worship __11: Evening Service.............. 7 P.M. Sunday Night Program ......... 7 P. Mz. 249 Baldwin Ave. Fed. 4-7172 Lowell D. Baggett. Choir Director May All of the Joys of Christmas Be Yours } Christmas Eve Communion Tonight at 10:30 P. M. Christmas Day Services Sunday at 9:00 A. M. and 11:00 A. M. Speaker: The Rev. Otto G. Schultz Christmas services at Grace Lutheran Church will present the saving message which neither time, nor institutions, nor customs have changed, the Gospel of the Love of God. ‘For unto you is born this day in the city of David a Savior, which is Christ the Lord.” E METHODIST CHURCH : 87 Lafayette (2 Blocks West of Sears) The Church of the Light an Life Hour MERRY CHRISTMAS. Classes fer All Sunday School .. 10:00 a. m. Morning Worship. .11:00 a.m. Evening Wership 7:30 p. m. j Lyal H. Howison, Pastor Mise Burtella Green Phone FE 2-9955 Sunday School Superintendent |||||! BRING THE FAMILY | Messiah, sung by the Independence Messiah Choir with THE WORLD-FAMOUS INDEPENDENCE MESSIAH CHOIR SINGS You are invited to hear Handel's immortal classic, selected soloists and members of the Kansas City Philharmonic Orchestra. Presented by the Reorganized — Church of Jesus Christ of Latter Day Saints, The 16th annual Christmas gift to the nation broadcast 8:00. P. M. Tonight, December 24, on CKLW Fangs we, oh Cbd LSEUAEASEPUUANNG ARDELL oh tan netN Ste: ate EAE AAA EAD EDERAL ERODES sanmsacett ee eepes oe oe ee S8. +S. AAP OF OF aa =# «4s Christmas just isn’t Christmas without a party. And parties always mean lots of fancy cakes and ice cream. Enjoying such an occasion in Bloomfield Hills recently were (left to right) Elizabeth Kerr, Frederick Barrett, son of the Edward Barretts of Ottawa drive; Gary and Andrea Christmas Calls Forth ~ Old Customs Birthday of Christ Observed in Many Traditional Ways In all Christian countries, Christ- "=" mas is celebrated as the birthday | of Christ. Scandinavian countries ** - still use the pagan name Yule Day | «s and Germany and Switzerland ob- | “s serve Holy Night. | > It is only in English-speaking. | countries that Christmas is used, | a the name coming from an early | _* English term, Christes Masse, | -* meaning Christ's Mass. . The date for Christmas in most . lands is Dec. 25. Ne one knows definitely when the Christmas festival was first celebrated as -@ other dates were often observed | * as the day of the Nativity.’ How- | ever, in the year 334, Bishop | Liberius of Rome ordered that | aS the celebration be held Dec. 25. The giving of presents and the _* of holly, mistletoe, ‘Yule: logs he the wassail bowl all come ~ to us from the days before Chris- tianity. ® s ° * All of these distinctly set Christ- e» mas apart from all other holidays. - To families today, the day would lose much of its festivities without * the Christmas tree and Santa’ * Claus. i « CIVIC FESTIVITIES : Today, too, community festivals _» are celebrated in many cities. Christmas trees are placed in cen- tral locations, glowing with lights, »* and people gather about to sing the familiar hymns and carols tell- . ing of the birth of Christ. Faces: Sh “Twas the night before Christmas a all through | the house” Katherine Widdifield reads the old familiar ine With Peptiace Preas Phetes Holcomb, children of Mr. and Mrs. Albert Holcomb of Birmingham, and Susan Kerr. Susan and Elizabeth are the daughters of Mr. and Mrs. Elton Kerr of Birmingham. Street. story to tiny Margaret and Ann. They are daughters of — is Many groups gather a few days before Christmas, singing carols and bringing baskets of canned foods, meats, vegetables and deli- = cacies. : Pageants are given and carols “" are sung around a Christmas e* tree or fireplace, and the baskets are distributed to worthy famt- . lies. This has established the cus- ~* tom of the White Christmas in ae many social and religious or- . ganizations. Singing as an expression of joy. hope and love has been a part of the Christmas celebration in ev ery, country. The custom of singing carols has been popular since the Middle Ages and is still a special feature of the Christmas season in -* many parts of the world. | Pies s * * | : Carolers visit hospitals and| #, homes to cheer the sick and the =. aged, as well as going about the «, 8Streets singing of Christmas joys. ‘HOLIDAY DELICACIES : The Christmas season is also * marked by tasty things to eat all) #4 over the world, and many people! 2 give parties to celebrate the oc-| casion. On Christmas Day most Ameri- can families will attend the church | ** of their choice, remembering the | », birthday of their Savior, and then| | ,, father for large family dinners, | ~~ Visit with friends and relatives, and| « exchange Christmas gifts and greetings. | —, 4 4 -’ Pontiac OES | “T he stockings were hung by the chimney with care,” ... Little Robert Mathews, son of Mr. and Mrs. Curtis Mathews of Bloomfield Hills, is one who’s hoping to get a glimpse of Santa this evening. the Rev. and Mrs. C. George Widdifield of West Pike *. Initiates Three | * _ Mrs, Floyd Levely, worthy ma- Operating Staff *- tron of Pontiac Chapter 228 OES se Presided at the recent meeting. Has Yule Party Dr. and Mrs. Aben Hoe kman “Elizabeth Rockefellow, Mrs. John| « Burnia and Mrs, James Chip Miner, Wash.,” Swartz Creek and Clark-|t the staff's Christmas party Fri- ston, \day evening. oo was called by Mrs. Lev-| mosphere. p Serving on the program commit- toast oblongs. ad cea ‘ bid 5 es ' ¢ tee were Mrs. Jack Stevenson, |Mrs. William Borland, Demetra - Hafris and Ted Hendrickson. Graee Bloomstrand, Patricia, Sue Livingston, Mrs. Ray ** were initiated into the order, Visi. Visi.|Were hosts to the operating room. Ritter and Mrs. Robert Lentz also tors were present from Aberdeen, |*t4ff of Pontiac General Hospital serveq on the committee. For’ acne holiday canapes, Refreshments were served by! The party was held in the recrea- canned hamburgers make delici-,afhered at a star shaped table . Group Three, wah ive Earl Ross tion room, with an open: hearth ous, hot* bites. Just heat, mash/centered with a Christmas tree « 8 chairman, A special Jan, 23 fire adding to the Christmas at-\with a little of the gravy that|and sang Christmas carols led by icomes with them and spread on|Albert Barnett. _The devotional message ‘‘Search at the church. 4 j Fellowship Class Has Yule Party The Christmas party of the Fel-| Y lowship Bible Class of the First] ‘Baptist Church was held Tuesday of the Shepherd’’ was given by Enno Prince. Several Christmas selections were played on bells by Mrs. Leone Reed. She was ac- lcompanied by Mrs. Frank Van Sixty-five members and guests also gave a flannelgraph message on the Four C’'s-Christmas, Cradle, Cross and Crown. Mr. and Mrs. Charles Lloyd were chairmen of the program. The group contributed gifts to be given to patients at the Oakland lsociation, gleefully suggests that ‘Husen at the piano. Mrs. Reed] : This is a very happy sea one, especially children. Little Caprice Chapman just clasps her hands with joy as she looks all about her—at all the won- Waiting eagerly for Santa is Bruce Annett Jr., SATURDAY, son of Mr. and Mrs. Bruce eae of Sylvan Shores drive. He even DECEMBER 24, 1955 | derful sights. son for every- Her big sister, Cheryl, and her brother, Chipper, join with her in the holiday merriment. Their pagents are the James Chapmans of Lone Pine road. } took down his stocking to make the job a little easier for old St. Nick. Women's Section PAGES 10-12. ‘Cranberries Are for Turkeys’ By PHYLLIS BATTELLE NEW YORK (INS)—It is a very competitive world and, as a con- sequence, the most respectable of industries tend to get a bit squir- rely around Christmas sales times. They decide that the best way to sell to themselves to the public is to turn suddenly sensational and frivolous and maybe just a teensy bit tipsy. Hence, we have jellied bourbon to put on our toast. Whisky-fla- v toothpaste to start our ing on a high plane. Butter- scotch made with the real stuff. And the latest—cranberry juice old-fashioneds, cranberry juice Midnight Mists, and C. J. Scarlet frappes. Cranberriés are still recommend- ed as a turkey complement, of course, but James Glover, presi- dent of the National Cranberry As- they have other more sensational uses. . “Treat your friends to a cran- berry juice wassail party this year,”’ he urges. eS different!” I took Glover's new cocktail idea to the friendly neighborhood bar- tender—a family man named Dom- inick—and his reaction was: already.” Dominick pointed out that the County Convalescent Hospital. sickens him slightly, partly be-! \cause no barman with personal make red stains on his chromium But mainly because of the prin- ciple of the thing. * * = “There are too many fancy alcoholic products these days,” he said ‘It used to be that you come up with a new type Christmas tree ornament, it was enougn novelty on Christmas. Now it's got to have alcohol in it or it's not a big seller.” Dom pointed out that apparent. ly stable industries “go bats” every Yule. Refined dairy com- panies start to “push” eggnogs and buttered rums. Fruit shippers pitch apple tod- dies and Orange Blossoms; Wor- cestershire sauce people plump for Bloody Marys and even cucumber lgrowers with advertising budgets speak out for Pimm's Cups. “It’s demoralizing how every- thing has to have a kick these 8 Circle Meetings Held This Week Eight circles of First Methodist Church -held Christmas meetings this week in -various members’ words, pride likes to deal in liquids which | “These people should ne drunk| homes. Among the groups ‘meeting were Anna, Mary, Rhoda, Elizabeth, thought of these new exotic drinks Joanne, Lois, Julia, andy Sarah. Yule Inspires Odd Alcoholic Beverages he said glumly. “Mark my the day is coming when they'll_put pernod in pablum!” FANCY POTIONS All the time he was talking, Dominick was taking notes on the ingredients of the cranberry de- lights: Fancy potions involving creme de menthe (for the frappe), rum or gin (for the old-fashioned), white wine and mint (for the cran- berry wine cup). * days,” e « bd “There’s always one,” he ex- plained, ‘‘who falls for a deal like this. Usually a blonde. Blondes like a drink to look cute.” ‘Scariett O'Hara,’ which was a wicked mixture the juice and jSouthern Comfort, in honor of Vivien Leigh. She is a brunette.” The Scarlett O'Hara gave bar- tenders headaches and ruby-stain- ed chrome for about two months before New Yorkers quickly re- verted to the old standby, the vertrrrry exxxxtra dry martini. Two months is about what Dom- . ) = ; THE PONTIAC PRESS. SATURDAY, DECEMBER 24, 1955 __KLEVEN —— Christmas Draws Families, Friends Together for Merry Celebrations * By MARGARET COLE | +— serenen a The beautiful 1 of celebrat- rty and ham dinner. G ! Rilo agen Staff Entertained _|Paryartm dome, Gis wor , Ma cial religious services and with fes- |. Mrs. Frederick Smith of Bloom-, : ; se . y tive family gatherings is being car- ea terrace remy ericrtaleed nenniskillen ee weap . ried on in Pontiac homes. he nurgery staff of St. Joseph Northern Ireland, cele : a io joys of D iieue (efi kaais asd ee Mercy Hospital with a Christmas 280th birthday. , ] ristmas toe, Yule logs, the exchange of nen ase nneeeeeenee , b t St Christmas trees glowing 4 j e yours with will add to the rejoicing 2 UACKIE RAE iar ns From All of Us! , lomes » center of ac- tivities, Amid the great excite- | Ardythe Wehri Nellie STUDIO meat of members of the family | me oe ™arr 4 ; E 214 S. Telegraph Rd. pabagiendenape) pron vist los b DDD DRM DRA RWAID family dinners on Christmas ae . _ Day, with open house, cocktail and supper parties continuing through the week. As is traditional, Dr. and Mrs. (C. T. Ekelund will entertain at an open house in their home on Ot- tawa drive this evening. On Christmas Day they will en- |tertain at a family dinner. Places will be marked for the Newton Skillmans Jr., Mr. and Mrs. Bruce Smith and Mr. and Mrs. George! Wellington Sralth of _Franklin. Gathering for dinner on Christ. mas Eve at the Robert E. Field home on South Avery road are their daughters, Suzanne, Bar- : : bara_and Joanne. = _J Mr. and Mrs. Lester McClellan Jr. and children, Karen, Kenneth! = . ; ; : and Janet, Mrs. Sue Long, Mr! We looked like this when the photog- editor, on the left. Next to her is Judith and Mrs. Harold Sibley and chil-| rapher, armed with a shatter-proof lens, L. Clemence, women’s editor; next are dren, Debbie and Danny, and . |Mr. and Mrs. Calvin F. Long and @"d his fellow conspirator, the caricature Margaret Cole and Joan Ritter, women’s children, Diana and David, of artist from the advertising department, staff writers. We all wish you a Merry Derothy McKinniss Mary Durfee Joanne Spranger Deifina Herr —Sylvenia. Leoni Mr. and Mrs. Harry Rendall \ RANDALL'S itarper Method Shop 88 Wayne Street Phone FE 2-1424 he We send these sincere Dearborn will also be present. | wandered by. That's Janet Odell, home Christmas and a joyous New Year. ; ni Another Christmas Eve dinners” a a : a greetings with will be hosted by Mr. and Mrs.| Christmas Day at the home of to spend the holidays with her son- Chapter Gathers ish that r Russell H. Galbraith of Cherokee! Mr. and Mrs. Arthur G. Nicho- in-law and daughter, Mr. and . : a wish that you road. lie on Franklin boulevard. ‘Mrs. Carmi J. Odell of Oxbow With Mrs. Smith . They will have as their guests) ,ttendi ill be M Lake road. . | A frosty white Scotch pine Christ-| Holiday Joys Mr. and Mrs. I. J. Isgrigg, Mr. pobert J. Alton and childeet Ban oe ‘mas tree decorated with bulbs was : : Robert J. Alton and children, Bar- . and Mrs William Isgrigg and sons. | bara Jean, Robert and Rodney:| ,f*- George Uthoff of Mount the centcspiece tor the Christmas| go far beyond your = f/John and Richard. Mr. and Mrs./Mr- and Mrs. Robert S. Castell Vere, lowa, arrived on Thurs- party of the Epsilon Rho Chapter, Robert G. Isgrigg and sons, Rob-|anq‘daughter, Judy: Mr. and Mrs. “Y te spend Christmas with her (of Reta Sigma Phi sorority. fondest dreams. ert Jr., Stephen and Scott, and william C. Ro : son-in-law and daughter, Mr. and | pourt bers and guests at-| of STORE ’ | ’. Rogers and children, : ; ourteen members and guests at-| |Dr. and Mrs. C. G. Burke and'pavid and Debby, and Mr. and MFs- Clarence Huemiller of Wal- tended the party at the home of! PARKING ison, Jerry, of Bloomfield Village.'Mrs, Donald A. Nicholie with their, ™ "4. | | |Mrs. Redlong Smith of Larbarta| ; %: J , drive. Mrs. M. A. Calbi, sorority oy | This Christmas will mark the aaa Corals Wency and Arthor ye and Mex George) McGill of advisor, was present. | Huron at Telegraph | 55th year that the Thomas Far- * « ‘East Iroquois road will have their ley family of Clarkst the | i a DINXTE Pore npy |r le oe eee eet Rs ee ee FOOL CL LS ELLE 4 NH, Lynch have gathered for lee the Christmas holiday at the and Mice’ James House and theie homes of Mr. and Mrs. Robert R. |, . 5281 Dixie Hwy. (Near Waterford) OR 3-1894 | “Brstmas dinner. \Wise of Premont street and Mr. children. Judy. Jimmy, Colleen and Mr. and Mrs. Nicholas Balz willland Mrs. Lero: ight phere. entertain at their home on Mar-|avenue. Kesey Smut — The Tom McGills will arrive quette street for dinner this year. * * -# \from Niles and the Robert McGills, Guests will include the George} Gathering around the dinner land sons, Mike and Paul, of Boston Cox family, Mr. and Mrs. George) table om Christmas Day at the @Venue will complete the family Burke, Mrs. Mary Lynch Burdick,| home of Mr. and Mrs. Jack (&4thering. Gertrude Balz, Mrs. Katherine] Brannack on Ogemaw read will | _ * oe and oe ee be the Donald Noggle family, Ann, Frances Capucille, Maurice) Mrs. Cecil Benson, Mrs. H. A. } O'Connor and Mrs. Carl Lenz and) Dennis, Mrs. ies anil /Mrs. George L. Brown of Voorheis + . * hte it. “es ‘road. They will visit with their i * : oat GI ates * poet th mee Evolva Dea a iviaw and daughter, Mr. and * Rivard and children, Janice and z , vic Mrs. M. D. Stapp and dauchter.| penne, and Dr. Frank H. Wal- Mrs. S. W. Clement. * : * Marsha, will entertain at dinner) por. _ SS | ( d this evening in their home on In- ee 6©« « a. Se i » td Ll Leaving Thursday to spend the holidays -in Chicago were Mr. and ¥ . verness drive. Their guests will in) yy. ang Mre. G corgel Gale aad Merry Christmas clude Mr. and Mrs. William Knud-! : sen and daughter, Patricia _and (hidren. Deborah and Geottrey, | Ae i Sledinnd: oO Birmingham will spend Christ-, — és mas Day in Lafayette, Ind. | Mr. and Mrs. William J. Ot mw Barnds and children of Arting- | Holiday guests at the home of 08 ton, Va., Ensign John E. Barnds |Mr. and Mrs. William J. Emerson, te —Te sal at A of Monterey, Calif. and Mrs. |of West Iroquois road are Mr. and eS fii To All Our Little Friends Ray F. ahd, of Freeport, ti., |Mrs. John A. Emerson of Owosso 5) and Their Families are visiting at the home of Mr. |and Brooks Emerson of New York De C or S op ang Mrs. William H. Barnds of (City. Delaware drive for the holidays. ~ YS | 48 N. PERRY * 8 @ Mrs. Arthur H. Oberndorfer of Pontiac Hotel Lobby Arriving home to spend the holi-| Wauwatosa, Wis., arrived Friday Gy» an days from the University of Miami jesssssssseesssnn ———————————————————— in Coral Gables, Fla., is Sally: : J Vif, “a 4 Elizabeth Kelly, daughter of the ff (Mt ~ sp Winton J. Kellys of Birmingham. 4; Li 4ei Sally is the granddaughter of By- “( ron J. Kelly of Cherokee road and “Wy too! sivalrechsacten” ac _ WASHINGTON (INS)—Movie pa- Reyal Oak. Mich. WASHINGTON (INS) — A $100,-\trons please note: : \000 Christmas story of which ra-| The Agriculture Department re- Li 6.1424 LI 6-1425 Iidio-TV star Arthur Godfrey is the! ported ominously today that the| central figure came to light today.| 1955 crop of popcorn was 16 mil-| Ss = —| Godfrey was disclosed to haveljion pounds—or seven per cent—| The [presented as a Christmas gift to ithe Air Force Aid Society the $100,- 000 paid him by a national mag- jazine for his life story, which was published recently, smaller than last year. This year’s harvest provides a} mere 213. million pounds for munching in darkened theaters or popping around the family hearth. BLUE SKY DRIVE-IN THEATER s * ® ry 1590 R Last year, the crop was 229 til 2150 Opdyke Road The amount is one of the larg-jjion pounds, which itself was well est ever paid for a serialized auto-/yejow the 10-year average of 252 Rey Hardy, Mgr. iography. The whopping Christmas gift was accomplished through the Arthur Godfrey Feandation, j hemganstoalosel byt Aeranase | 1 million pounds. KEEGO THEATRE SUNDAY DOORS OPEN TV personality and his financial advisers in 1950 for a number of including charitable HE SCREEN WITH THRILLS! Doors Opens 12:45. CELL 2455, — DEATH ROW , purposes, activities. Godfrey turned over the $100,000 to the foundation, which made the presentation to the Air Fonce Aid Society. SPECIAL CHRISTMAS MATINEE MONDAY 1:15 The. True Story of joseph McConnell, America's Triple jet Ace — His Life and His Love TUES.-WED.- THURS. Doors Opens 12:45 The society, of which Capt. Ed- idie Rickenbacker is president, is aj civilian organization devoted to the} welfare of dependents of Air Force| personnel, including the widows] and orphans of men who have per-| jished in the service of their coun-| s , try. | * * * rr.’ kd ALAN ;) _ JUNE gi) ALLYSON LADD “l) Me CONNELL STORY Jack Brauhey *| Friends of Godfrey said the gift! - Helen Cramer reflected the star’s keen interest] MORWONEGD-. Bill Grant in all phases of military aviation. | anything i Ay Ed McNamara Folkestone, England, fishermen os . laré trying to catch a stinging jel- ilyfish_— to treat a man who was, H. W. Porter ree, Jim McNamara Y, + case iit x iat see lta, by one recently. i ¥ SATURDAY, DECEMBER 24, 1955 Group Planning for Restoration of Wayside Inn [| SUDBURY, Mass. ®—Local ofti- cials and residents have moved for restoration of the historic Way-| | TONITE’S FEATURE fire early Thursday, * * «@ The Selectmen appealed to the ~teay Foundation's Wayside Inn, Inc., which owns and operates the referred to as the “national shrine.” * * s A group of 20 residents met to A Merry Pope Gives His | Peace Message |” Pontiff Warns World side Inn which was destroyed by} That ‘Restricted View’ | Is False Outlook VATICAN CITY (@®—Pope. Pius XII, in his 17th Christmas mes- sage to the world, today called upon men to rededicate them- selves to Christian principles. “We reject. communism as a social system in view of Christian Christmas & Happy discuss plans for getting the inn restored. A similar meeting was held by the town's clergymen. ae Tia Ne Si eS Sh WM Te Ne tt te Spokesmen for the Foundation! New Year announced in Dearborn, Mich. yithat the ruins will be surveyed |; Our Feoture 4 with a view toward reconstruction * , Wish for You The late — — purchased and Yours the site in the early 1920s and restored it to the way it looked when built about 1686. He also purchased m of the early per- fod creitere > refurnish it. The inn became famous when it f|was the inspiration for Henry Elden Sameels, Mgr. Wadsworth Longfellow's ‘‘Tales | PONTIAC DRIVE-IN THEATER ee@memems ia Wayside Inn.” SeOES ESOS ES SS SSDS SESS, head of the Roman Catholic jdoctrine, " said the 79-year-old ‘head of thee Roman Catholic’ church. He spoke from his golden throne | lin the Consistoria] Hall of the Vati- ‘jean Palace, The Pope's message, an annual, every year since he was elected, plea for peace which he has made to St. Peter’s throne, was carried by radio to countries throughout the world, Repeating the anyels’ words to the shepherds on the hill the night that Christ was born, the Pope said: Lo e Ll “Fear not for behold I bring you good tidings of great joy that ‘oan be to all the pedple.” (Luke Po: 10). THE PONTIAC PRESS, FIFTEEN. api i ag mage “SERRE AaB dren fe j Ike Lauds Port Huron Eisenhower has sent a telegram ‘to the city of Port H offering his “warm congratulations on its selection as an All-American City.” “Their display of civic spirit and their effective action point the way to advancement in other commun- ities throughout the land,’ the tel- PORT HURON ® — President rece smd egram said. Port Huron was named an All-American City in a mt contest sponsored by the National Municipal League and Look magazine, University Hall on the Brown University campus was used as a barracks by American and French troops during the American Revo- lution. Tomorrow—Christmes Day Show Begins At 3:00 P. M. — STARTING TODAY -— | a George Nader, co-stars, agree the answer to the first riddle may be found in their new Technicolor, CinemaScope movie, which also features ey Kallen and Bert Lahr. Holiday Will Jam Telephone Circuits WASHINGTON — Don't cuss ETERNAL RIDDLE — “The Second Greatest Sex,” forthcoming U-I musical, brings up a rid- dle to rival the old question ‘“‘Which came first —the chicken or the egg?” Jeanne Crain and Hollywood Headlines Laughton Again Will Give HOLE \? w ry: OYyous «4 lies FOR THE FAMILY / Christmas E ve Readings By BOB THOMAS pa, on the Ed Sullivan Show. A HOLLYWOOD w& — Tonight a es eager beaver named Paul| Hearing the ringing words of the ifrail Pope were cardinals in their} scarlet robes, ecclesiastical and, lay dignitaries of the papal court, | the telephone operator if your holi- day calls don't go through as) quickly as you think they should. | Holiday WISHES. To all our friends we wish good cheer, not only Roman clergymen and members of the Pope's family. “How we wish,” the Pope said, | “that all men scattered over the continents, in cities, in villages, in valleys, in deserts, on steppes on stretches of ice and seas, on the! whole globe would again hear as though it were said to each one of them in particular—the voice of an angel announcing the mystery of divine grandeur and of infinite love.” , ‘ LJ But the pontiff warned that “‘one must ask oneself with fearful anxiety whether modern man is disposed to let himself be ap- Circuits will be jammed, said| Joseph A. Beirne, president of the} Communications Workers of Amer-/ ica said in a statement. He sug- cron that long-distance calls on ‘jolly fat man will be opening his adres caught the act in a bar bag of delights on television, No,|2%4 Sought out the actor. Gregory, ‘Inot- Santa Claus. It’s Charles a former actor himself and then an Laughton. jagent, was convinced the readings * «8 ‘had an audience, He booked Laugh- NBC's Christmas gift to the na- ‘on for a tour and their associa- tion wili be cherubic Charles read- ion, has led to a million-dollar ling from his favorite selections in © producing attractions the hour before midpight. And like “Don Juan in Hell,” “John though he professes to shun senti- Brown's Body,” “Caine Mutiny mentality, he admits, “It's rather (Court Martial” and a film, “Night nice to be thought of as some- °f the Hunter.” la tradition at Christ-' Boda Judge, Nation’s Oldest, Hears Last Case | working at least one shift over Christmas and again at New Year’s, he said. “Remember that the operator is doing her best. Be patient with the unavoidable delays, These opera- tors . .. will. be working while America celebrates, They are en- titled to the utmost in friendly consideration.” s At his home just “ Hollywood Boulevard, Laughton brought out his battered old reading bag and proached by so much supernatural “In reality,” the Pope continued, “modern man, exactly because he| possesses all that human spirit and |labor have produced in the course \of time, should recognize the even more infinite distance between his immediate work and that of the immense God.” But the Pope said that reality is! very different because of false and restricted view of the world and of life accepted by men. for Christmas, but for all of the coming New Year. , THE DORMANS Closed Christmas Day! Serving Our Wonderful Feeds Monday, December 26 OLD MILL TAVERN ¢ displayed its contents, The satchel contained a frayed copy of “Pick-| WASHINGTON ®—The nation’s wick Papers” which he had had oldest active federal judge is leav- since boyhood, plus other books he ing the bench. plans to read tonight — the Bible,, Jennings Bailey, who became a ‘James Thurber, Thomas Wolfe, judge in June, 1918, announced last ete. night that he has heard his last “This bag has seen a lot of Case. |duty,”” he reflected. “It was al-| Although oe A d Spiga ways a good prop. If I had a par- since October iley has) g, “ yarriors,” iticularly cold audience, I would continued to serve as a Distriet| Starts omg oan Pilea “Lord spill it on the fidor at the start.;Court judge ever since. Now he! > i) Jungle,” Wayne Morris. |That would warm them up for is going on an inactive retired , 6 7 4 se WATERFORD, MICH ve Al me. It also helped if I had the most status. | STRAND disreputable of chairs. Sometimes| fal “28 : “Top Gun,” Sterling Ley, P HOUGHTON iW — A free ski the (er a it. ” . June, was named a judge of the’ Hae, be ila sUranium, " Leo onli school sponsored by Michigan Tech, old District fo Columbia Supreme Gorcey, Huntz Hall. re) DOORS OPEN ON OuR @ and a Houghton sporting goods) Aree reading for public Court by President Wilson. The Wed., Sat.: Walt Disney’s ‘The Pontiac Theaters OAKLAND Sat.: “Heidi and Peter,” color; “Border City Rustlers.”’ Sun., Wed.: ‘‘Pompey’s Head,” Richard Egan; “‘The Adventures of Sadie," Joan Collins. - eseessessesesessesesasess * % ¢® WEEK vars | GIANT store is expected to draw more consumption dates back to World court’s name since has been ‘African Lion;” “Peter and the MOM, Pop A ND AL L TH E A ; AT 10:45 \ 'than 100 students next week. It\War II when he toured service changed to Pee ne Wolf.” a ! «© sunpars 12:45 SCREEN © wi open Dec. 27 and rin through hospitals with the bag of books. | _ KIDS WILL Z OVE | on ea Last. Times nes Today — “ULYSSES” @ Dec. 30, The school has turned He said that he tried for years to’ Bailey is a mie of Nashville, New Zealand insurance com: : re | pe a GP out more than 600 skiers in the get his agents to book him thea- Tenn. His father, James E. Bailey, | ‘panies are worried because peo- Also SEVEN _ANGRY_MEN™ _ gy rast seven yetrs, Michigan Tech tically asa feader, but made no a Confederate oie, served iN ple are sleeping on top of their| WED.—"The African Lion” and “Poter and the Wel!” cone! Who sup- headway. Ree Le ~ electric blankets. Some of them re) | @ \ ervises activities, has 17 instruc-| =e Judge Bailey won a reputation’ @ STARTS TOMORROW! 9g: | ‘en one night he di some sele./among, lawyers for clear sad ner may EVE awaken, they sayin | GALA NEW YEAR'S EVE. Show Sat., Dec. Sist @ TH “8 ad —— |cise rulings. He also had a reputa _ E 4 tion for insisting that lawyers get 4) 4) 4) 4) 4) 4) 4) al a! a) « «) 4) 4) <4) 4 4/4 e p C if lJ RE | quickly to points at issue. Bailey! @. v - never relished the sensational and ® , . iofional cases found in criminal : @ THAT = ° courts. Since his official retirement) @ | ; 0 as was his privilege, he has de-# CCl enta | im H TS N) 24 voted himself almost exclusively to. @ 2 civil trials. ; LIKE a A , of 2nd Detroit ‘Riverama’ — e tum e @ eo Slated Aug. 15-Sept. 1 . @ eo DETROIT w — “Riverama”, a/& ; @ eo [Detroit civic festival staged on a ‘ th _ : 3 Scomen¢| On the Truth... repeated and enlarged in ar, @ Le Hx & Hounds Iun R. T. Johnstone, who served!® The commander. a small ener _ Both of the young teenagers are getic man with a personality as, appy and bape to Lg ehh 3 Thumb Area Banks forceful as iptide, is b for | cre rT. merican families ; gral gi area nce Tell of Merger Plans this Christmas, but as Jose said— ithere is “No hay lugar como el pan AXE, w—Merger of three ;hogar"—(no place like home). lthumbe area banks with offices in TIME | The veteran sailor has little time, il 69 Pp C Mail 69 Per Cent ° Above 1954 in Lapeer «: Plans call for merging the Hub- jfor “those few reserves who just LAPEER — Outgoing mail from bard State Bank of Bad Axe, the nities has been tentatively ap- |proved, Charles E. Williams, pres- Veterans Post Given ‘put in their time and are afraid ‘ident of the banks, announced to- 'to Lloyd H. Jameson to do a little work.” DETROIT u—Lloyd H, Jameson) today was appointed U. S. Veter-, ans Administration regional man-| ager in Detroit, succeeding Guy |F. Palmer, who retired. Jameson, used te rough ways,” Cmdr. jan attorney, also is commanding) Burns said. “I told her he would officer of the 319th Logistical Re- do exactly what the rest of his |serves at Fort Wayne. He lives in| men did and get treated the same ‘Ferndale. | way. Maybe we'll make a man of him.” | The skipper delights in retell- “A young seaman's mother | once cautioned me to be careful with her son, because he wasn’t above last year. A new daily rec- State Bank. ord wa sset Dec. 10 when 40.000 If the merger is approved by Pieces of mail were cancelled. shareholders, Williams said it, Last year the outgoing mail (would make the Hubbard State 600 and for the same dates this |thumb area. It would have assets, year, 176,000. and liabilities in excess of $12 mil-| There are six extra clerks and jion, he added. they are working until 10 p.m. or, {10:30 p.m. each night. | Bond Is Set at $5,000, | | c ling his Alaskan experiences, but ‘Man to Appear in Court |he is reticent when it comes to his | FERNDALE — DeVillard Wynn,'World War II feats. 22, of Detroit, was arraigned before| Cmdr. Burns commanded the, \Justice Earl N. Nash yesterday and Submarine _chaser McClane for. Reveal En bond has been set for $5.000. He two years in Alaskan waters dur- | LAPEER—Mr will appear before Judge H. Rus- ing the war. He earned the le-) “\) Ein: ee. ie Wilh sell Holland in Oakland County gion of merit and sank a P Pete ch en ene = Gagne pad ° rae at ‘ire an. 3, é anese submarine. ee" s Sa el ic ania berate to ae coma! A olyn, to Ellsworth Kile, son of Mr. jured yesterday in an auto acci-; |women here Thursday night. ,/and Mrs. Ralph Kile, Hadley. A,dent while en route to Caldwell, | \Lake Orion Man Injured | gagement | LAKE ORION—Reported to be in. _ and Mrs. Thomas’ {air condition in the Norwalk, Ohio, * = “The sub gave us quite a chase.””: June 9 wedding j a ; Wynn has been turned over to,the skipper said. “But we ee Space ee ee ——— Detroit police for questioning in him.” 5 POOLE CS CS OSC SSL LCC CSCC SE the purse-snatching and death, last ; = 4 . a ag pea Enlisting in the navy in 1928, anes of Amanda Johnson, 72, he resigned his lieut re , a DRUG . mission in 1940 and joined the , } Se coast guard as a warrant officer | . After commanding the coast | STORES Baptist Camp Head guard ship Citrus, he took over , Takes New Position | the McClane. —-. . | LAPEER—The Rev. Floyd Comp-| Cmdr. Burns has a son serving ton, head of the Detroit Baptist in the Navy, another who is a) Camp at Lake Bronson, near tugboat engineer, and three daugh- cepted a pastorate at Mt. Morris, He plans a fitting retirernent ‘and will move soon. for an old seadog. He intends to} | The Rev. Compton took an active move to Oregon where he'll be part in many activities. in the com-| closer to the sea and his old stamp- |munity. He is now on vacation in|ing grounds in the northern Paci- New York. ; | fie. The Christmas greetings 4, ; we send to you, hold every good wish for a Joyous Holiday Season. _ Neisner’s Shoe Store . / 42 North Saginaw Street ¥ ie ie ns i ie DR. HAROLD BUSSEY, OPTOMETRIST extends a wish for a happy holiday season and future peace and prosperity to all friends an patients. TO ALL OUR WEST: HURON (AT TELEGRAPH) ~ DRAYTON PLAINS - 4985 Dixie Highway Be Open All Day Christmas DR. H. BUSSEY Optometrist Eyes ‘Examined i faut at Next te wees Theater FE 4-5211 Stores Will | \ f |’ NORTH BRANCH—A sixth fac-| lfive central Huron County commu-| Lapeer post office is 69 per cent.Elkton State Bank and the Kinde’ for Dec. 14 through 19 -was 107,- Bank the largest in the upper} | Buckner Finance \Lapeer,. for many years, has ac- ters. i I \ | 30% Off t As another Season approe ches, we would like to ) | take this opportunity to wish our many friends | @ wonderful Christmas! GREEN’S Men’s Wear OR 3-1807 } 4516 Dixie Highway Drayton Plains ——— | \ TO ALL YOU WONDERFUL PEOPLE! May your stockings be filled with the best of gifts! May you have a truly warm Christmas and a grand, happy New Year! | | You Can Park at Our Door! 4512 Dixie Hwy. _ Drayton Plains OR 3-1221 Other Offices: Pontiac—Walled Lake—Utica OPEN ‘til 9 p.m. Christmas Eve-. All SUNBEAM Appliances All Electric RAZORS Casco. STEAM IRONS a ee ae we AR en RR a agg a Garsgy ge) | cecum Sige se eorgs apo Net | eh el : a RUSS’ COUNTRY STORE “AN $DD LICENSED STORE 4500 Elizabeth: Lake Road | i Po /< “HOME. OF. ‘NELLIE'S” 3 __ SATURDAY, DECEMBER 24, 1955 Lansing after local contests in |stead of Osseo as chairman and the spring. The 1956 princess will [Charles E. Stone of Lansing as be chosen from county represen- |*°CTetary-treasurer. “~6- tatives. THE PONTIAC PRESS, Ask High ACout io \Title Changed SEVENTEEN ,| Old Faithful, Yellowstone’s most/ ireguiar intervals that occur 58 famous geyser, spouts at almost | minutes apart. . sonaeeenveretannsanemaesiiiinsimmesiasis MERRY CHRISTMAS To Each and Every One of You! mm! “Sa apy If you have bought or received a clothing gift from my store ... and it happens to be the wrong size or color... 1! would appreciate it very much if you bring it back for exchange ... My policy is... “You MUST be satisfied with your PURCHASE or GIFT” ... That’s why MY STORE is one of the Fastest Growing in Pontiac! Sam Benson— the Man Who Brought Low Prices to Pontiac ‘Dist. Judge Edward A. Tamm inl ‘the case of Clarice B, Covert, 35, |who was convicted by an Air Force ‘court-martial in England of ax jmurder of her husband, Sgt. Ed-' (V Reverse Rule to P rincess In the past, selections were made 1 ST iafter district eliminations con- ; LANSING, @— Michigan ducted throughout the state. aan iwill have a dairy princess in 1956 The i = Military Seeks Its. Own instead of a dairy queen as in past! committee elected Ivan May- Buses without conductors are running in Sheffield, England. Fares are put in slot machines and passenger volunteers open doors and signal the drivers. pecan A Merry Christmas to you all! May goodwill and happiness be in abundance on this joyous Holiday Jurisdiction Over Its 0 june dairy month commit. j j Accompanying Civilians tee of the American Dairy Assn.,| |meeting at Michigan State Uni-| : iversity, decided to change the title) w SMGTGA aeons o because the national organization ere as govern chooses a national dairy queen. me reg locggrek a ous = chooses a national dairy princess. overseas are subject to military| minor changes in the method of trials, | s¢lecting the princess. Each county wilt acnd a b candidate to REETEN FOR A JOYOUS HOLIDAY GREGORY’S JEWELRY for all our fiends and patrons! 1211 North Perry St. i At Madison Street FE 3-9557 Louis Soucy Dist. Atty, Leo A, Rover . 9a YOUR KEEGO HARBOR JEWELER 'pealed a contrary ruling by U. ward E, Covert. * * * Mrs, Covert, formerly of Av-, gusta, Ga. received a life sen- tence. Her conviction was reversed | on a technicality by the U. S.! Court of Military Appeals and) she was awaiting a second trial when Judge Tamm set her free on) grounds the military court had no! right to try her. Tamm’s decision upset the his-, torial practice by the armed serv-' ices of exercising jurisdiction over i‘‘camp followers” of military men |overseas — meaning as a practical jmater. their wives and depend-| cents. | Tamm ruled that civilians ac-| .cused of crimes were entitled to trial by civilian courts, Safecrackers Blamed for Starting Big Fire NEWARK, NJ. w — a ‘crackers using ai-acetylene torch! |were blamed for touching off a spectacular half million dollar fire, early today that wrecked an auto, sales agency along with 25 new cars, The thieves burned into two safes at Ward Motors but failed to get $20,000 in Christmas bonus money found in one of them. Fire officials believe the thieves| dropped their flaming torch on the! floor, starting the fire. A World Bank loan of $5,300 000 will aid Japan's largest steel lenterprise. LOS ANGELES RAMS vs. CLEVELAND BROWNS WW4J-TV, Chann Monday, DECEMBER 26, 4:00 P. LOS ANGELES RAMS LE LT LG c RG 80 Fears 78 Lipscomb 60 Ellena 50 Mc- 63 Hock 8) Miller 62 McFadin 61 Putnam Laughlin 68 Fournet 86 Bighead 73 Cross 67 Richter 56 Morris — 7) Fuller 58 Griffin 57 Paul - QB LHB RHB FB 22 Haynes 23 McCor- 21 Quinlan mick 27 Waller 25 Bur- 4) Cason roughs 43 Sherman 40 Hirsch 48 Taylor 49 Hughes CLEVELAND BROWNS © Le LT LG ci RG 62 Massey 72 Kissell 64 Gibron 52 Gatski 60 Bradley 88 Brewster 79 Gain 79 Gain 54 Palumbo 62 Forester 84Gillom , 65 Noll - ‘ OB LHB RHB FB 24 Lahr 20 Paul 26 Renfro 32 Morri- 43 Smith son 22 Konz -M. (EST) 31 Morris 32 Towler 35 Younger 30 Bassett 34 Michaels 36 Modze- 40 Jones . lewski el 4 RT RE 65 Hauser 82 Boyd 70 Toogood 84 Robus- 79 Holtz- telli man 20 Lewis RT 70 Colo 74 McCor- mack 78 Sandusky 44 Petitbon 54 Perini 42 James Brought to you with the good wishes of CENTRAL DISTIBUTORS 375 Frenklin Rood MILLER BREWING CO, _,, SHmAOREE, 48 : Downtown . THE CHAMPAGNE OF oF BOTILE er. moilineeneal puny é : : : : f ve ) ioe ! : - if " “ ; { - % oie my This... IS CHRISTMAS Now, from near and far, fam- ilies gather to multiply their Christmas joys by sharing them with loved ones, older ones, friends and children . . . Festive tree, sparkling lights, fragrant boughs and holly, gifts unwrapped, dinner together... Voices joined in song and Prayer are rituals of Christmas, of belonging to one another... If this is so for-a family at Christmas, may it also be for this state, this nation, a world of community nations. When at this blessed moment, an in- ner voice murmurs “'Listen, the. guns are silent, there is Peace on Earth!” Tel-Huron Center ee Pa iad | -* THE PONTIAC PRESS, SATURDAY, DECEMBER 24, 1955 Joe's ggmm—And They Can Say, ‘Merry Christmas Everybody’ | t 6 buted and all of it is going for'gress. And Rose Ellen, although{at a Christmas paity’i the polio| smiling and they shouted almost in Army- medical expenses. already marked was spared further|ward of Research Hospital this/union: Wis A PROUD MAN agony. week. When they left, both were’ “Merry Christmas.” : Navy The couple's oldest child, Lor-| Edward’s relapse was a blow. - te. Surplus 32 S. Saginaw St. EIGHTEEN, Two of ward. Then -in=rapid succession twins Julia and Joan, 13; Ann 15; DURAND, Ill. (INS) ~ sifarmer Keron Walsh's 14 chiidren jare in the hospital, and another Susan, 11; Bernard, 7, (the only -'one needs a brace to walk. But it|one who had been inoculated with '),| Will be a Merry Christmas in their sai; vaccine); Frances, 2, and even * modest Durand home. \iateee Mollie, now 2. The reason, Walsh said today,, “It’s as though we were picked is: “It’s enough that they all are; out,” the 53-year-old hog farmer lalive after what happened." -“What happened” was that 10 of the Walshes’ i4 children were stricken by polio almost simul- taneously. The tragic stroke of fate brought! world-wide attention to the tiny northwestern Ilinois community. Citizens of all lands shared farmer Walsh's gref and demonstrated it | by swamping the town’s post office iwith letters of sympathy and en- couragement, and gifts. ALL WILL HELP Today, 15 weeks after the first raine, 18, went to New. York to| Bet the Walshes are too busy to lappear on a national television pro-| |feel sorry for themselves, and they ‘gram to tell their story. But all are convinced everything will turn she asked for was prayers. jout pretty well. . _ The Less Joseph Driscoll of Walsh and his wife visited David ARE YOU MOVING? FE 2-0022 | ied Lorraine on the trip, said | only polio rel ; ees in en-| Pan tire Winnebago County, with the| ®t the time: “Walsh is a proud t t of] mae moe not looting for &- sisal ie comty seat 1 ot Vccachaill hsipi'l(lie'siicsking’ Ser | prayers.” KEPT HIS FAITH * * But Walsh, a deeply religious Their prayers were answered, at man, did not lose faith. He and his least in part. Seven of the chil-! wife, Anne, 45, carried on as best dren. who suffered comparatively | they could—comforting the sick mild attacks and were eared ones, caring for the four children early. recovered quickly. David, | mercifully spared and tending who had been near death for | their 360-acre farm. ;weeks.-perked up and was able to| of the 10 children was stric Relativ peta ‘ jleave the iron lung. Edward, also interest in the family remains hi bors did = best ees the aa began making good pro-| Interdenominational prayers still 2 — are said in the churches, the town’s 679 residents — to a man — stand ready and willing to aid in any way they can, and the cards and letters keep pouring in. As the holidays draw near, we realize the importance of your friendship and hope the New Year will see a continuance of this very pleasant relationship. Call Smith Moving Co. 485 Marion FE 4-4864 4. May we extend a truly sincere wish for a Merry Christmas and may every good thing be yours during the coming New Year! se JOE and AL JACOBSON Norm Travis from Belgium. “It’s written in | Belgian,” he said. “And there's mo one around to interpret it. But I know just about what it says. And J'm grateful that peo- cover the costs. The Winnebago. chapter of the National Institute for Infantile Paralysis and radio station WREX in Rockford went to bat for them and launched a) - * ¢ » But there remained a serious = me — financial problem. Walsh had in-| nak ioe Just this week Walsh got one | surance, but it would not begin to. t —_ \ 1 se Co Ye~ « Sam Lividotti | 4 4 ple so far away think of us and “M ik e” M ye rs remember us in their prayers.” Seven of the 10 children stricken ‘now are fully recovered. .- The other three, however, face long and tortuous months before they can begin to resume normal lives. Rose Ellen, 5, the first of the family to contract the disease, is out of the hospital and able to get around despite a crippled right leg encased in a heavy girdle-brace. But she still must go in for treat- ments. SUFFERS RELAPSE Two older boys—David, 17, and) _Edward, 16,—are still in the hos- | pital. They are afflicted with the |most serious type of polio—Bulbar —and it will be some time before they can rejoin their family. . Edward, who had been making | good progress toward recovery | and even managed to stand at his ; oo | bedside for short periods, suf- enjoy a Merry Christmas | fered a relapse 10 days ago and | had to be put back in an iron | tung at Rockford’s St. Andrews | Hospital. fund raising campaign. Walsh said more than $9,000 has been contri. | John Bacinski eonenes “Howdy-do's", the "Wish you well's" remind us it's Christmas . . . here's wishing you a Merry One! Tim Brooks The jingle bells, the spicy smells, the 4 3 MERRY Gertrude Gabert | CHRISTMAS Ss. Sins hn Ba es hn Da Ms Bh hn Sha a Ms Ms Se es Ss. Ss he Sa ee co |SEAT COVER MART 136 S. Saginaw at Chase FE 4-8272 PONTIAC WAYNE GABERT Your Electrical Appliance Specialist i Wayne Gabert i i an i i is i M.S Se Me Me te t 121 N. Saginaw Street De RMAMRDDPM ABI DD RDB DF PIPPI HMRI. AHAAPTRITR AD, May you and your family TO ALL! ¥ May the ae Pvceclin ele he you this Holiday! Gallagher’s MUSIC CO. 16-18 E. Huron St. There is a possibility he will ‘join his older brother at the Uni- |versity of Mlinois Research Hos-| Pontiac pital in Chicago, where David has Home- Wittiam Waricut been a patient since Oct. 26. | makers GRIEF STRICKEN : Furnit ke ti cc for urniture Makers and Upholsterers Walsh ternal all aniet cinickea ites Over 270 ORCHARD LAKE AVE. wildered man when the epidemic « 23 Years! . hit his household Sept. 5. First | Rose Ellen. _Then David and Ed-| Serving ARCHIE BARNETT SID BARNETT | In the spirit of the Holiday Season We extend our hearty thanks for your Friendship and Patronage and our wishes for Your Happiness and Prosperity in the New Year &£27—>@ Whether for a twin bed or a‘ big double bed, there’s an automatic blanket for anyone on your Christmas gift list. : It’s the gift that keeps on giving from the moment it’s plugged in. All night long, all winter long you get luxurious warmth without muscle- -cramping weight. Automatic blankets are wonderful gifts for all the family. see YOUR DEALER or Detroit Edison 2 tsp / fe . . ee i Bae Be, Pontia’s Oldest ia | | THE PONTIAC PRESS. SATURDAY, DECEMBER 24, 1955 | | : NINETEEN > sheriff and chiet| = : : 7 Former Officer Dies moma: # police | = Safe After 4-Day Ordeal eres: 5 chapmth tne Ag A Ma a5) ui was the night before Chrismas y } When all through the house -4 » Tlot a creature a on event a mouse day afternoon after lost for - four days im a seeey roess in “the Cascade Mountains Washing- By SGT. JON M. HORAN I flew like aflash, ~ € open We shutters and threw up the sash, he moon onthe breast of the rew-fallen snow, Gave the lustre of mid-day to gg objects ‘below, When, what to my wondering eyes should appear, But a miniature sleighsand eight tiny reindeer, FOUND COCOA 6.5 mae 8 ee ' , [ I found some matches and got a SGT. JOHN M. HORAN |fire going. I found some cocoa, . ‘melted some snow and moved as|in an old ice box. I cut open my|kept raining until I was soaked to ith a little old driver, a er close to the fire as I could, I|Doots so I could get them on my|the skin but I couldn't stop. ques didn’t know it then but T was going| feet and wrapped on the boott and) 1 igh came and it looked hope- I knew in a moment it must be St.llick “ to live on that cocoa for the next|the racks with strips TY ‘tess. But I kept plodding along on Mo i four days. parachute. those ridiculous ice-box racks. te Tap id t an eagles his courgers they they came, < (ESC or eS) CGC io whistled, and shouted, and called them by name eut of there. I found some shin- |very good snow shoes but they It was then I decided I was going | gies, made some rede snow |worked. to make it. : | et oe NT took @ last look around the! tye rain got worse and I gt Fou. Dasher! now, Dancer! now, Prancer and Vixen! colder but I began to feel real but off in the distance'T could hear a set out. Tt was noon Wednes- hope for the first time. I dropped On! Comet, on! Cupid, ontDunder and Blitzen! Yaintly the roar of trucks. bof over the rim of a hill and I could ect f the \ oth of the wall - May your holidays be rich in the pleasant _Linew help wasn't too far. oe any sen one Sy Se OE dash « t porch! to top of i | I it 500 feet. a or L M BE WA Pag llrgealg ve get png tal ag lange oll | dla angen Ne away |'dash sway! dash away alll through the year ... and may che inspication came back to the cabin and slept.| pretty weak with nothing but (came around a bend, I saw two The next eight cups oe po mae bw 7 Sea en SS lee a dry leaves that before the wild hurricane fly, : : est everything wi eting rr the RM ae‘ wot wees “eee When they meet with Be obstacle, oo to the s «tecpeed and ied ag.” pty raed tthe wet ant itt eas poy tm Br 7 up to the ease: top the coursers they flew, alee ae tay tas |e co ied tape cn he roca tet th the sleigh full , and Si.Ticholas too. “Tee peetty discomaged. | ArT walked I wondered about |!0¥- ee ee ee ee ee ee Se SP a ke ee a See Ce a ee ee Senos a ’ & * TWENTY-TWO ; THE PONTIAC PRESS, SATURDAY, DECEMBER 24, 1955 . = = 4 * LJ = _/ i + ” | ; made Use of dagga (a drug) has! Paraguay will exchange cotton| ' m'-8 | Pion leaf aons that — Fegan pe ypteagelindl yen a spread from teenagers to primary | for Bolivian petroleum products! | = __ . Po aoe to re a ship’s|cotton and Tibetan wool, says Dr. school children in South Africa. ‘| under a new trade pact. - it om Oo cat lost overboard from a naval|P. K. Sarkar of the Indian Central | z LEAT ieee launch a mile away. Jute Research Laboratories. I Cheatin] | SLERPING es St Her BH -LAUmDRY: -|_B STORAGL- on . [ rth a re STuby DIN! fF] geet te oes | ; SLELPING ~} Ho ir-ox 4 [1]! ar is Ci OL we (igecsss a ] a Is-@* is | t ee — ‘ea = eaeteeae MALL: PPY we Boe GARAGL: jb 4 C sansssavecbecss : , . y : | Cc "es e ; ORLAKTAST T MEATING lid FL peach lg Ch ae] ot olf ays er oe seas 5 ' he UJ iy % ” t R As vei a. i LIVING j . $ Voices are ~ ig" 4 30° RECREATION TYPE jes lifted in praise f:.2\ OC © clad Ose se COMPARE! of Christmas, we ° aj [9sess) - kt. 5 LOOK — SEE — COM wish our — aoe coapsea! x 4 ae WISE BUYERS GET OUR PRICE TO BE SURE y - jepeeesa| - FREE ESTIMATES — 36 MONTHS TO PAY friends all the Soesbog i T-700 Open 6 Days o Week — 7:30 A.M. to 6 P.M. fn a Happy | j : 1661 South y Season! G C ; Good Investment, Comfort == FE 4-2598 Telaypagh Are 2 Building Requisites ae — — re uilding Requisites : — | Two major objectives to keep in|room. These create wall spaces BATEMAN-KAMPSEN REALTY 60. mind when you plan to build a new for furniture as well as providing WE BUY OR SELL - - ‘house are comfort for your fam- fngpe aati or cabinets on . ly and security for your invest-| Comfortable seating space for LAND CONTRACTS : ° ment. The absic plan of the house eight persons or more is provided | ; Dr ayton Floor F ashions must comform with these two pre-|in the dining room, which measure * FE 4-0528 * - —74 dominating requirements even be- 13 by 15 feet. The living room is Ask for Tom Bateman : fore you try to meet them by)18 by 30. Smallest room in the | 4667 Dixie Highway OR 3-2552 selecting various quality materials house is the cozy study, 10% by! IT P LEASES US — TO PLEASE You and appurtenances. i13. a : a FOURTH BEDROOM POSSIBLE : Your Dream Kitchen Rooms must be large enough and) conveniently arranged to appeal to! The study, with its own fireplace, ‘ lis so located that it ean be con-| kee (the most popular preferences. If verted into‘a fourth Alf |you skimp or compromise on room a fourth bedroom. sizes, window areas, ease of pas- bedrooms are isolated from the sage through the house and on other fundamental elements of de-| ‘sign, you not only will be court- ing constant anoyance while living in the house but also a curtailed resale value and therefore an im- pairment of your investment. | The House of The Week, De- | sign T-700 on this page demon- | strates the advantages of big | | Teoms, generous spade for furni- | | ture placement, uncrowded pas» sageways, places to stretch your | Custom-Built to Exact Measurements! Built of Matched Panels of Select Birch Any Built-In Feature Such as: : THERMADOR RANGES AND OVENS ELECTRIC DISHWASHERS VENTILATING HOODS FOOD FREEZERS LAZY SUSANS ' COUNTER TOPS OF GENUINE FORMICA OR COVED MICARTA about the bricabrac. | Brightly lighted interiors| | achieved by expansive glass areas, Finest Quality Modern. , Colonial or Contemporary Hardware | IG cae in designing and building Custom Dream Kitch- ens Bathroom Vanities,jor your new @ or to modernize your peeeent home. Prices include complete installation. Esti- f] numerous and: useful closets . . | —e Terms Avail _ \plus glamor — three fireplaces, | h ve BI NEI "S “ Pp | wo double chimneys, indoor plant. | |ing, sliding glass doors, three tiled | ‘bathrooms and a two-car garage, Mon * are also features. cree Meoaay aay de frees Planned by W. H. Schumacher, 3088 West Huron step. ag FE 5-9331 Oklahoma City architect, this house _| Spreading roof, which has wide living part of the house and can be raised two steps above the living room level for added privacy. The bedroom hall can be closed off by a door. The front bedroom has a large private bath and a dressing room. The second bath is off the hall be- tween two rear bedrooms. A third! bath, complete with shower stall, is conveniently placed adjacent to| the backdoor to facilitate cleaning up after outdoor activities. An exterior of light colored brick with ledge stone planting boxes is suggested by the archi- tect. Specifications also call for gray asphalt shingles on the low, built-in oven separates the kitchen and breakfast area of recreation room. These rooms open into one another. overhangs on all sides. The overall length of the house, including garage, is 111 feet, 8 inches. At the deepest point, from the front of the recreation room to the back of the kitchen wall, the measurement is 42 feet. The house is an outstanding exafnple of how the Southwest is influencing home ithe garage, laundry and storage |proper covers 2,200 square feet and —— INDOOR PLANTING — In the corner of the recreation room an Goodwill Automatic Heating 3401 West Huron re ipo tw fe fe fe ye fro fe feore sr The HY HAVEN SPECIAL A 45 FOOT RANCH HOME ~ MODEL ADDRESS — 4945 SASHABAW ROAD Ke Y STANDARD BUILDERS design from coast to coast. . | AMPLE STORAGE SPACE Ample storage space and an! oversize heater room eliminate the| | jneéd for a basement. Economy ac-} | cruing from basementless con- istruction permits the inclusion of ja large recreation or family room le ground. | recreation room is one of |most interesting features of the |house. It measures 14 by 18 feet: room add 550 square feet. indoor planter matches the outdoor planting boxes. Sliding glass doors at the right lead to the living room. Ly TR ee ee weak Be Northwest Management Co, 1 |It has floor-to-ceiling window walls, is separated from the living room by sliding glass doors in aluminum frames and it has direct access to an indoor barbecue fireplace in the kitchen. “Most families,” says Architect | Schumacher, “like a barbecue | fireplace. When this is placed on a garden terrace or elsewhere ‘outside the house, it cannot be used the year round., In this house the barbecue is in- corporated into the kitchen, form- ing a wall between the kitchen and the breakfast area in the recrea- Mey goodwill fl you. homes with joy end peste! MIDWEST I @ Nas SUPPLY 9 NORTH TELEGRAPH 1 Re PRR as . FE 5-2102 | tion room. 8 ‘ | “Inetuding an iron oven, Dutch|§ THE PONTIAC PRESS ‘ ~ style, this barbecue grill has all the 8 | : Whi facilities for roasting and broiling's Building Editor: : ' s regular meals as well as for char-', Enclosed is 35 cents. Please send me a copy of the study, § = coaling hamburgers or other g plan for The House of The Week, Design T-700. No stamps - |snacks to be served in the family § accepted. 6 163 Montcalm io : Spaciousness is emphasized | xv aME _ ; - a throughout the living-dining area 5 (Please Print) + by the use of stub-partition room 3 H dividers, surmounted by dowels : a or other grille work rising to the ’ STREET ee | ceiling. a : One grille separates the living® H room from the entrance foyer. : CiTY STATE ! The other marks off the dining SES SUB SSSSSSSSFSSSSSFSSSFeeeeeq ae ) * a® “ * *. * : * = efec0 o** *,* @ .¢ 76 seteretess . * TO EACH AND * *, *e*s* EVERY ONE OF YOu! We're wrapping our Yuletide greetings up fer yoy la the brightest ribbon we con find! Good luck and lots of happiness in the coming Now. Yoor! TO ALL! _~ May this very heartfelt wish follow _ you and your family throughout the Holiday Season and the New Year to come. Pray with us that men of all nations remember the true FILLED WITH JOY AND CHEER meaning of Christmas. if an cei, co kee From All" TRU-BILT BLOCK CO, : - MASONRY BUILDERS’. SUPPLIES - . | F Sosa 1992 Pontiac Drive > sR 4.9531 , 11 North Perry St. | ’ ‘Mase Telegraph and Orcherd Lake Rawle } ~ ‘ i ’ : [ES ae ie Ato — : ‘ S . 4 j . . : * | : oy age | fa ened oe | 7 : fie Coe) | ro ' ny a) ee ; ae , | | ‘ ‘ ; en - g + « Of All Things! You can keep your feet warm at home or at work with a neo- prene rubber mat 14 by 21 inches powered by electricity. Plug it lin, and the mat throws off warmth while using less power than a 75- watt electric light. = Finland expects to sell abroad 170,000 mink pelts in 1956. THE gregh: oy seater. oe Se ee "s ¢ _ ree : : ae - be ee ~ May time “_* _ many contentment, blessings of home, family and Pontiac, Mich. your holiday season be a of gaiety and excitement and a time, too, of quiet warm with the friends. PONTIAC PRECAST CO. 54 Sheffield Street OR 3-9741 eg We. eK 4 is eee “« © i ty b _ Gi TERMS LOW FHA AND Biall Kbewer in Second Bathreom er ee oh epg We RRR gE eerie geette cee oe PONTIAC PRESS, SATURDAY, DECEMBER 24, 1955 Fur Revamping Rag Rug Styles ] NEW YORK (INS) — Grandma used to make her rag rugs from odd scraps of fabric, but the latest styles show these same carpets made out of fur. : | Handwoven fur - and - cloth rugs have been designed by Monica \Broner. The general effect is something that looks like a bear- ‘skin rug that got peppered with | buckshot, | The heavy-looking, furry version lof the Victorian Polar rug is being made both in carpet and uphol- istery fabric with various types of ‘fur. : The random striping of fur and cloth for an. unusual effect is available in fabric plus fur for | $37.50 a yard, or $300 for a rug. hare, pony, Persian lamb — and mink! Miss Broner, a German artist | The furs involved are Belgian | TWENTY-THREE Grandson Uses Lumber Splashbacks Help ‘Cut by Gramps in 1870's Are splashbacks really neces-|in Sary? The answer, of COUrsé, iS | jae Indian businessmen will start a enterprise $6,316,000 paperboard Bihar Statée-- Here's an item with a believe-it- or-Not twist. Back in the 1870's, C. H. Dudley felled some longleaf |Southern pine trees. Today, some 5 years later, his grandson, A, a lected areas were protected with| Dudley, Sr., of Columbus, Ga., iS q stainproof, easily cleaned sur- about to use the lumber from those face like decorative ceramic tile.' trees to build a lake-side summer your kitchen would stay bright an colorful forever. yes and here's why. Stains from frying and cooking in the average kitchen, if left untouchéd, within a month can all but obscure the orig- inal color of your walls. If the af-| home The wood, still in excellent con-| . dition and given added beauty by Because the legal profession is ithe years, originally went to build overcrowded in India, a move is _a factory on the banks of the Shat-\afoot to force lawyers to retire at jtahoochee River. Recently, the fac- 65, Calcutta reports. | Wm. A. Kennedy 3097 W. Huron. FOR NEW HOMES Gi or FHA See REALTOR FE 4-3569 tory was razed, Dudley purchased; —— the salvaged lumber to use in its| jnatual color for flooring, ceiling) and paneling in his summer home. | | About 20 per cent of American, ‘eight-year-olds and 95 per cent of, the 70-year-olds have marked eye | | | aeiecta: 78 West Huron ! Merry Christmas to One and All Ray O’Neil Real Estate Member of Cooperative Real Exchange FE 3-7103 Carole Acres Beautiful brick homes in the outstanding Walled Lake Aree oe ° DIRECTIONS: who has designed these fur-striped | ‘rugs for a new collection of fab-| | 2 rics, has attempted to create a) —— Take Pontiac Trail or Maple Road to Decker Road. Follow Signs (west of) Orchard Lake Road te Model en Decker Road. O’Brien Heating & Supply 371 Voorheis Rd. tree apron is made of polyethylene to catch spilled water and drop- ping needles and provide a festive background for gift packages. Spread on the floor with the tree set up on it, the 72-inch square apron can be gathered around the base to hide the tree-holder. Dirt washes off easily and the apron can be. used over and over. For Greater Warmth, ots suet Rearrange Heating — where they can be easily reached iq - fashioned heating systems, when preparing vegetables. ‘with heat distributors misplaced on Pci are best kept in the storage inside walls, cause dissatisfaction pebgattd of the range, since there is pecause of inability to control chill- no reason to use them until the pan ing drafts originating around win- ! S i" on the stove burner. \dows. The only really comfortable | | For Convenience, Place Kettles, Pans Near Sink | 4 imaterial that is both casual and) : luxurious looking. WAITING The rugs are right in keeping] with the latest trends toward an’ for linteresting texture look — what) . ‘could make more of a contrast than’ . flat fabric and soft fur? FARMS | There is one word of caution for those interested in buying the new ifabric—they haven't figured out and how to clean it yet. i ' A Call to US VAN HORN and SONS HEATED CONCRETE CINDER BLOCKS 199 Mechanic Street Will Bring Immediate Action! REAL ESTATE TRANSACTIONS John Chiera Co. | Midwest 4-8200 JOrdan 6-3978 | CRUMP ELECTRIC 3465 Auburn Ave., Auburn Heights, Mich., FE 4-3575 Birmingham, Mich. i i |spot in rooms heated from’ the in-| |side out is close up to the source | Hang Evergreen «<< | \tors are admirably suited fo this ‘requirement of good heating, the mas? Here's one that will delight wall beneath windows. Even in a) the whgle family because they'll free-standing installation, if recess- entwined with colored bulbs im (warm air settling from ceiling to | graceful loops above the door. | floor strikes a cold window. Con-| | | The correct way to heat is from Over Doorway Bureau emphasizes, | have an opportunity to watch how ing is impractical, they take up Hang long sprays of greens | vectors prevent this by blanketing| , - | Buy or make a huge red and| Convectors distribute the comfort} J / YCONE tS, 1S jwhite plaid stocking and stuff with of hot water heat, supplied by a_ wa the outside in—with heating units | placed beneath windows. Convec-| Looking for a new idea for your Compactly designed, convectors doorway decoration this Christ- can be completely recessed in the it’s put together. little space. | Drape evergreen festoeoning, | Drafts are set in motion when topped with bright red plastic |windows with a rising curtain of, bows at each side of the door. warmth. i newspaper which has been rolled boiler. Cool air at floor level is into hard balls. Fill the top of the drawn in at the bottom through stocking with inexpensive toys. jan arched opening in the cabinet. Midst the many greetings that will come to you this Christmas, we want A you to include our wishes for a ye joyous Holiday anda Rich 39” and Happy New Year. From the Staff of Keego Hardware No. | 3041 Orchard Lake Read .. .. FE. 2+3766 PEACE, HAPPINESS and PROSPERITY. May these three wishes follow you and your family throughout the blessed Christ- mas Seasontand the ensuing New Year! KOOLVENT METAL AWNINGS Sales of Ockland County ’ ‘'T. MACKEL 110 CASS LAKE ROAD—PONTIAC. ibe prevented. The secret is sand-) at one side of the entrance step. Here's a tip for an easy way to make these effective lighted pack- Place two huge lighted packages /¢nclosure. warm air released) through a grille opening at the top, in a gentle, positive, and con- tinuous heating cycle. At ages. Use the end of an orange crate for the base. Fasten a porcelain | socket in the center and insert | a 60- or 100-watt bulb, depending | on the size of the package. Now, fashion a wire -frame to ‘the wooden base to form a box-| like structure. Cover with plastic shower curtain - type material, INSTALL TIiIMREN Silent Automatic Olin HEAT javailable in yard goods depart-| ments, and trim with plastic “‘rib-| bon"’-in a contrasting color. For additional highlights on the) door, hide a 1530-watt spotlight be-| hind the larger package and aim)! it at the Christmas stocking. | (WO MONEY: 36 MONTHS \) \ Down! . \. TO PAY! Established 1910 A. ELBLING & SONS @ Heating @ Alr Conditioning @ Sheet Metal Werk @ Reofing 73 S. Parke FE 4-1504 i} «+. we cannot help but ij i) gheistn"s remember the many kind favors weve received frcm our patrons and our many triends may you all enjoy the best! AUTOMATIC ALL YEAR THROUGH... We hope the joyous spirit of the Yuletide will remain with Heating Co. 17 Orchard Loke Ave. | Color Variations Make | Rooms Warm or Cool To “warm” a room that always seems chilly, select a wall color that belongs to the family of hues known as ‘warm colors."’ These are the reds, oranges, yellows and yellow-greens. Such variations of these colors as rose, terra cotta! and dark ivory would, of course belong in this group. | To “cool” a room, engage the: services of the cool blues, violets, blue-greens or blue-grays. Use That Sandpaper Blisters dn hands often caused by rough-edged tool handles can papering the handles of hammers, hoes, shovels, etc. The job should be started with number three sand- paper and finished with a finer grade : | omen Comfort Condition ‘YOUR HOME WITH Lennex Perima-flo Gas or Oil Heat May the Spirit of. Christmas fill your ‘homes and hearts with new Hope for the year to come, hold added happiness for all. May the futyre . the Christmas bells have ceased » to toll. May you find health Immediate Installation |} R th L b Cc | . KAST FURNACE CO, jj ~ 0 um er , 0. , 82 N, Cows Fe 5-9670 | 3360 W. Huron FE 5-6910 | baat i | - *y S | “Where the Home Begins” you and your family long after = and happiness in the New Year. BURKE LUMBER CO. 4495 DIXIE HIGHWAY AT DRAYTON PLAINS ‘Telephone ORlando 3-1211 mia Y i » TWENTY-FOUR THE PONTIAC PRESS, SATURDAY, DECEMBER 24, 1955 eR ES eE We Wish You a_ Merry Christmas WL R. Nicholie INSURANCE AGENCY , 49 Mt. Clemens Phone FE 2-2326 PAY S430 ONLY 4l’ MONTH NATIONAL HOMES 2 and 3 BEDROOMS LOCATION; Model Open Only t.2 miles north of Union Lake Village 1 P.M. to 8 P.M. en Union Lake Rd, turn left at Hutchins : Rd Daily and Sundays of St. Patrick's Catholic Chureh JOHNSON CONSTRUCTION Model Home Phone EM 3-3977 Ottice Phone Mi 4-0328 VETS—Can You Afford $59 Per Month for a 3-Bedroom Home? . between $500 and $600 (includ- ing all costs) will buy a 1956 3-bed- Clover room National Home . . . complete!y s ovet f irnished . . . and monthly payments ty) < are only $59 ; = @ School on © Youngstown . SHvER GEL | Preperty Kitchens JUDAH QD. Say UL @ Automatic @ Cedar Shake s Gas Heat Exteriors Open 8 A.M. ‘til Dork : § Judah Lake Estates x = Quarry Tile Does It sig scaffolding for stoirways, ‘Thin’ Strip Flooring Brings Beauty to Home oe Much Cheaper ‘ime nace "eee «Than Shoveling . |Special ‘‘thin’’ strip flooring of jnorthern hard maple, which will | bring beauty and cleanliness to the! That it costs only ‘about five to room. The %” thickness in the six cents per hour to melt snow jl". 2", or 2%" face widths is on walks and driveways by using /popular for this purpose, but the hot water indirectly heated by the| Se” thickness may very satislac- house heating boiler is disclosed by jonny jhe used. “Thin” hardwood research work at the University] | flooring, modestly priced, is avail- of qhinois lable through many local retail | "Aa 4 A jlumber dealers throughout the ee The research program, spon- jsored by The Institute of Boiler ,and Radiator Manufacturers, was iconducted by using the driveway | A weatherproof, permanently and walk at the I-B-R Research | handsome driveway—sure to pique|Home just off the campus of the j your neighbor's envy — can be University of Mlinois. made of colorful quarry tile. Al The snow melting system con- |hosing down every So often Will sisted of 325 feet of iron pipe, | keep it clear of oil stains, dirt and) three-fourths of an inch In di- grime. If you already have a ter-) ameter, installed under the drive- /race of quarry tile, a quarry drive- way and under the walk at the | way will serve to complement the | 1.B-R Research Home, The pipe Modern Men Use Ancient Asphalt for Many Projects You would naturally assume that a material old enough to have been used to caulk Noah's ark and to seal the mummies of ancient Egypt would have long ago been eclipsed by a superior weather- proofing material. i * * scheduled for use this year, how- ever, are only slightly less than two-thirds of the 125 million bar- rels of asphalt that a magazine predicts will be used in 1961. The construction industry, es- pecially the roadbuilding part of the industry, is the chief con- sumer. Seventy per cent of all- the asphalt marketed in 1954 went for paving, split about evenly between maintenance work and new roads. * * * Another 20 per cent of the 1954 output of asphalt was used by the |decorative scheme of ‘your ere | was laid parallel, 12 inches | — | apart. The top of the pipe was two STEEL ‘inches below the top surface of the concrete. The system was turned on by hand when ever a snowfall “ap- peared likely. The system then operated continuously until turned| off by hand after the snow was) |melted and the danger of snow-) ‘fall was past SCAFFOLDING | for every requirement. '] Rollir.g trestles and special stores, churches and bank I lobbies. A similar snow melting system “ | can be installed in connection | Syntron Electric Ham-] with any house heating boiler, mers. Tools for every either hot water or steam, the need Plumbing and Heating Indus- HUGUS-MARSH ROOFING & INSULATION CO. | tries Bureau points out. Mall Concrete | All that is required is the nec- ‘essary piping under the walks and; Surfacers and Grinders driveways and a connection with a heat exchanger which in turn is connected with the house heating boiler. Thus the water in the boiler is not directly circulated in the ‘coils. This would not be desirable because the water under the walks Sanders—Belt, Vibrating and Disc c eason's reetings <= To all our friends and patrons, we extend our warmest greetings for S A _ joyous Holiday Season. May the happiness of you ond your loved ones be as everlasting as the evergreen. A Merry Christmas and Happy New Year to all our friends. | AMBASSADOR INSULATION 483 Elizabeth Lake Road ‘=, Se: Se ee ee 'F gWDBRRBRD WMD DIA Tarpaulins Carlon Plastic Sewer Pipe {Mixer Park, Inc. 4245 Elizabeth Lake Road Ph. FE 5-8780 At nominal cost, controls can be ‘added to the snow melting sys- |tem. This will eliminate the need of any manual attention through- ‘out the winter. California, the second largest of the states, is 127 times greater in total area than all of Rhode Island. Commercial and Industrial Wiring Specialists BALLARD ELECTRIC CO. The 86 million barrels of asphalt DDB Cb OO Ot i i i tt tt ip te tp et i i i a a, ak, A Joyous Holiday Season | roofing and siding industry, with) asphalt roofing shingles and in-| sulating siding taking large quanti- ties of asphalt. Dartmouth college dates its founding back to 1769. rw. Very ye ye eee tl cl hit thin hl i i Ml ti it | Catt i te i al a i i i i i i it i hin he te th 4 4 4 4 4 4 « q q 4 4 4 4 4 4 REINFORCING BARS ; HOT ROLLED AND COLD FINISHED BARS; ROUND—SQUARE. FLAT HOT ROLLED SHEETS: AND PLATES Pontiac Welding &: } Machine Works 3. p64 N. Parke FE 2-41213 POOP POSTE CCT C COA, PINE LAKE 3 Bedroom, Ranch Roman Brick Home 2620 & 2720 Middlebelt Rd. $18,000 Complete Plus Lot Easy Terms Available COGEN Construction Co. LI 5-0143 .. . Call Anytime Model Open Daily & Sunday | to 6 VuevuvvuveT Vvvvwww 436 Orchard Lake Ave. FRIENDS AND PATRONS ‘Oakland Fuel and Paint FE 5-6150 643 BG. Paddock St. FE 46-6201 | Dawson & Watson | @. J. Mawsen, Hugh A. Watesn 11% N. Saginaw Se. Ph. FE 2-5420, Pontiac To every home .. . to every heart ... we're sending a sleigh-load of We want to add our SUE warmest wishes to everyone for a most Best wishes for a re joyous Yuletide. \ Glorious Yuletide! Donaldson Lumber Co. 27 Orchard Lake | CHURCH’S INC. 107 Squirrel Rd. ~ Complete Basement Waterproofing All Work Guaranteed — Free Estimates! GREETINGS ° Happily, do we follow a & wonderful old custom of &, wishing all our friends i a@ very Merry Christmas and a Happy New Year. AGENCY, lnc. fl FEDERAL Reliable Waterproofing 24 Whitfield Phone FE 4-0777 hee ye i 4 iat Ae Merry «Christmas \ \) From all the folks at... Bob's Building Service v iy = aa ~N . 207 W. Montcalm __ Ye y A. Murray White Robert E. White 53-8172 . —s Ss eS SS SSS SSeS joyous | | STORM | GRILL | With Every [No Money Down ‘Aluminum DOORS Christmas Special FREE Purchase of 2 Doors LOW LOW PRICES NO PRESSURE Call for Free Estimates LOWER PRICES Here Because WE ARE DISTRIBUTORS | CO. 1702 S, Telegraph Christmas wishes. May Santa ful- fill your brightest expectations, and may the warm glow of the holi- day season remain to brighten your ~ memories through many a month to come. Merry Christmas, every- body! y y & OVER THE WEEK-END / * SEE THESE 2 GREAT BUYS — The Drayton ¥ 2-BEDROOM HOME 4s asa ¥w See the Great Buy With ~~ = Many Features! © S$ M Oak Floors — Tile Baths — = F.A. Oil Heat — Colored Fix- ~ | 'g, tures — Copper Plumbing — 's, Automatic Gas Hot Water Plus Texes end Insurance Monthly ‘ff Heater — Youngstown Payments Kitchens. $382 From Pontiac Go Out Dixie Hwy. (US-10) to Sashabaw » =e Eldorado 3-BEDROOM HOME dhs dS ~~ < All Gas Home in Clarkston Gardens te Loaded with features for tomorrow's living — 3 large bedrooms, F 12 baths, large living room with smart window wall — Gas ‘i heat, gas disposal unit — Large lots on winding blacktop roads ; ... bearing fruit trees... fire hydrants — First home in Clarkston x with community water — Storms and screens, too. ~ Drive Out Dixie Highway to Clarkston Road (M-15) to = Waldon—Turn Right on Waldon, Pass High School to Model. ge~=sCOWWHKITE BROS. = REAL ESTATE : Office at 5660 Dixic Highway — Water 27 yf FE 5.3728 PHONES OR 3-1295—OR 3-1872 , ~— aaa fr fr THE PONTIAC PRESS: SATURDAY, DECEMBER 24, 1933 | TWENTY-FIVE AAAS AOL a . : rs ’ yi | eal Esuie eae }DOn't Give Your Furniture a ‘Brush-Off Wocd Panel Cuts 25 Pet. oo sew Lett or ' ..» At Its Best! _ of Home Heat in Winter | IMMEDIATE OCCUPANCY with | Don't give your furniture a'with some good ae cleaning fabrics, particularly if Wood siding keeps home inter- | , | quick “brush offs” If you expect ‘that, if followed, will assure longer! over foam rubber, is to be sure the iors cooler in summer, the U,S.| GAS H EAT life for upholstered pieces. vuvurYy —_ To Buy or Sell Real Estate or Land Contracts... yevvvvvevvevwvuvvvevw?v.? bl i i hi hi hh lh te Hl SEE } to get the best = trom it. and dirt i : |fluid used has either a water Department of Agriculture a WM i KNUDSEN < * Dust ve been found | hase or is a non-distilled type of ports, yet has nearly 25 per cent a ee ave recently com-| to have an abrasive effect | cleaner. ’ ‘less heat loss in winter weather, Lerge, New Realtor ; left in fabrics. The constan : 3-BEDROOM $10 Pontiac Bank B: | pleted a study of cleaning methods ccbbtng aatlenlet Gall oad — COVER SMALL AREAS than other types of exterior) bd E 0 Phone FE 4-4516 >and have found homemakers are| : bd finishes. | e POOP TOTS LOO oon? heir upholstered| Particles can destroy any fabric. | The cleaning fluid should be Tye reason is that nature had ‘HO ME OO nn tas WANPPPAe | apt to neglect their ui Upholstered furniture should be | used in small areas at a time and pyijt into such woods as Douglas. ~ ‘|'furniture. .They have come up vacuumed at least once a week | should never be allowed to soak fir, West Coast hemlock and west- FOR ONLY COMMERCE, MILFORD, PONTIAC, , all over, especially under the (through the covering onto the up- q,. red cedar, three of the most] seat cushions. Reversing the |holstery. popular species for sidmg lumber, |] § ioe WEST BLOOMFIELD, HIGHLAND — RANCH-TYPE cushions tends to keep the fabric | Co nounds generally accept- a natural insulation of tiny cells. —— MONTH 2-BEDROOM and LAKE AREA ONLY 6 LEFT... HURRY! [| cmocth Siting. | able for cleaning fabric over | Alternating pockets of woody Spots and stains should be re-| foam rubber include seaps, and (substance and air make a perfect moved as soon as they are detergents, a mild solution of |insulator against cold and heat. Yes, we are doing a super-market *plus taxes and tnsurance noticed. The best rule to follow; carbon tetrachloride or am- 900 sq. ft. of living space, and business in real estate. But we are monia. Also effective are gtyc- | Construction threatens to reach|J constructed with many quality not stocking our shelves fast 4 4 4 > 4 30-Dey Occupancy — Be in Before Christmos! > crine and denatured alcohol, it an all-time high in Brazil's lead-|] features. enough to meet the demands of i ities. ij our customers. M 4 is best to choose nonflammable, "8 © TOTAL FH PAYMENTS ONLY 665 sere Msnhatinn. Ost Ferry Decorate Your cleaners. | i] PRICE $ TERMS Our 5 office organization is run- / $ 4 PER itm *4 Foam rubber is sturdier, how-| We Service All Makes of | ning low oe coe, UST ~ 4 WONTH - OPEN SATURDAY and SUNDAY >| ' ever, than many fabrics used over Oil and Gas | Pay Only $750 Down! I help Dae vei nail considering tL —end— ; cane _— co 9 io > aste a efs it; so a test should be made on HEATING SYSTEMS DIRECTIONS TO MODEL selling! iphone (eneliol our (otfices Your lacs y an unexposed area of the cover Ing '] Prive north on Perry, turn left on |B most convenient to the property Dont YoU PAY ONLY C tvie H Inc. 4 to determine whether the material We Feature the |] Seslyn, then left again en Third. you wish to sell. $ 5 50 = res Ww omes, 4) NEW YORK (INS)—It’s fine to will clean without discoloration. Williamson Furnaces || Mode! nome to open ot 516 Thire. 1 with a Sold by CASTELL REALTY es Be sure to check the label on | | Do a Double Favor! © Abe G. L Financip ne LI 1-1795 q|throw things in the waste basket,| |. product you plan to buy, to So Se MODEL OPEN DAILY Help us by enabling us to i“ but the waste basket itself shouldn't nae sure it does not contain ele- All hf aaa AND SUNDAYS tell about and show your property = look ready for the garbage pile.| ments which would be harmful peel neem I to our large list of waiting buyers. On the other hand, you don’t! to upholsteries, sueh as vinegar, L & R HEATING Built by |] Help yourself . . . by getting the | ‘have to buy the baskets on saletchiorine, turpentine, _ acetone, | BVG Investment Co. maximum showing and results on | q j in New York these days—on sale) peroxide or acids. - your property. | at $60 a throw. They are one-of- es 228 Oatiangr Aten FE 5-6623 | reere fe Se Remember . . . a great number of buyers of Oakland County a-kind models covered with em-| When the homemaker invests in : properties come from the greater Detroit area. Our organization broidered oriental scenes, complete! good furniture, she expects it to. having Northwestern Detroit Offices and 2 Offices in the local area, with fine silk, gold thread and an jast and she can help insure its is well equipped to do the job you want done. occasional jewel. The basket cov-' jong life by giv ing. it good care. | erings were cut up from old, aur) thentic Persian robes. Instead, perhaps you have an old! kimino that's been hidden away! in the back of the storage closet— take it out, cut it to fit your shab-| biest looking waste basket and, paste it on for a new look. | Another good ‘‘covering’’ mate- rial is wallpaper—this way you's, not only get a basket that looks ‘like new, but you can match it to your wallpaper for the smart, co- ordinated look. Another idea for the waste bas- ket is souvenirs—the kind you keep/= collecting dust for some time and eventually throw away. Instead, Got to See LAKE OAKLAND HEIGHTS. Walton Blvd. E. of Sashabaw So... haven't got time Live Yeor ‘Round at LAKEWOOD VILLAGE In Oakland County's Most Fabulous 1,000 Acre Development where nearly all lots are on the Coca Located 10 miles directly west of Pontiac on M-59. to talk now... 112 Baths perhaps you have a collection of > SOFTENS colorful matchbook covers, stamps Ly or theater stubs. > REGENERATES 4 —— MILFORD... For $300 Down G. 1.s can buy a 3- Measure the circumference of| (TSeLe Bedroom Brick New Home with full basement ... . Brick Ranch Homes | 60 ft. wide lot, on paved streets. Also available on your basket, then plot out on the} FHA . . . slightly higher down payment. f Ey by neste an Ga Dod Models at ; pletely cover the basket by rows. $] 5 500 New Development at Summit and First Sts. | Plot for color combinations as well ij as size. Ge paste them on. \cowex | Tower includes lot Olfices at Olfices at ° | =— = 7400 Highlend Rd. M-59 8081 Commerce Rd. Does Your Child Ruin N+ ais) cease | canons ati: EMpire 3-4236 EMpire 3-4197 Furnituré at Home?» HH. STANTON C. SCHUETT REALTY, Ine. NEW YORK (INS)—Parents who! 103 State FE 5-1683 3 Detroit Offices Phone KE 2-2400 think home decoration is dandy in| the living room but wasted in the! —_——___—- nursery shouldn't be surprised if 3?-““C'"™™----—— — their children act like littl: hellions all through the house. ‘What else can you expect when people insist on making their chil- dren live in barns ‘until they're) old enough to appreciate things?’ " Good Luck, Good Cheer asks William Pahlmann, ‘The chil- dren grow up as taste delinquents. Instead of learning to appreciate | H their home, they turn the whole! Throughout the coming year o7e0e house into a shambles.” | Pahlmann, a handsome, 40-ish' New York aatiatealns bid aS bachelor, has ne’ less . From your good friends ‘with “about a thousand” children'§ May your family hearth in his 20 years as a decorator.|¥ be warm with happiness 4 : _ And he’s willing to argue the ques-i@ ot Christmas . . . may @| The folks ‘round here... | tion of decorating a child's room |% its good cheer long glow 4 . with any proud parent. in r memory. This “Children are practical people, ” : you = Y: ‘Pahimann says. “You can't tell|g@ 'S OUF Sincere wish for | them to keep their hands off the you. eves room sofa and then laugh Vets: $795 MOVES YOU RIGHT IN! ROCHESTER PARKLAND Ranch Homes! a ite Nien Nie te Ni i ee SS i i eee S| Be ae head they kick in their own furni-|¥ | ture. They know this doesn't make |@ @ ; | Sense.’ d e Oldest Living Thing Herbert C. Davis 4 The oldest living thing on earth ¥ Baa) Estate—Builder , LUMBER co. is believed to be a tree—a cypress uy ; HARDWARE © COAL © BUILDING SUPPLIES | Cc—* Rio del Tulle, Mexico. The 4925 Pontiac Lake Road National Lumber Manufacturers | . 181 CAKLAND FE 44-1594 Association says the tree is esti-' OR 3-7614 mated to be between 5,000 and |7,000 years old. 3-BEDROOM BRICK RANCH HOME with GAS HEAT and Full BASEMENT er ane a lore 4=7:\ MODEL HEATED CONCRETE ... AT NO EXTRA CHARGE! Viel ages Ve) = On LOW, LOW MONTHLY PAYMENTS TAXES ARE LOWER IN ROCHESTER ANery 0 pas Merry Christmas | | Seasons” ‘To Each and Every One of You Aleaioamn from All of Us at... Windows Call FE 2-0283 Bf x thore Seal $87 FULL MONTHLY PAYMENTS $15,395 Low FHA DOWN PAYMENT HAS ALL THE BIG CITY CONVENIENCES Read Loaded with Custom Features Found in Homes Selling to $30,000! * nivel Cement Concrete . Paint AREA HOUSE : (Gov. App.) © Public schools, elementary and high. © 70-toot wide lots. * Machine Parochial schools, Catholic and Lutheran, ° and screens included. ms ATSMAN ce Peers Pipe | ® Township — a eee eotermnee. picnicking, SMart ac tk ; + Si & TRANSIT-MIX CONCRETE , © Seate-atecked tout streams sight in the Scuedd eat ae Sand delevopment. ; © Rough-in lav. basement. Gravel 399 S. PADDOCK ST. 2: ae ene nal a 1) 3 spasiee bk copkene: : ; = = . —o in living room and * Quality © City water and sewers. © Glass bathtub enclosure. Building © Police! and fire protection. © Jaleusie in kitchen. E xclusive Sales by ee | , ic BZERT GORDON Realty Co. TWENTY-SIX THE PONTIAC PRESS, SATURDAY, DECEMBER 23, 1955 ne Westridge - of - Waterford Northern Pontiac's Finest Subdivision Area Featuring Custom-Built Homes ot Distinction MODEL UNDER CONSTRUCTION -. 4192 Ledgestone Drive Sundoys 1:00 to 6:00 P. M. or by appointment DIRECTIONS: Off Dixie Hwy., Lane to Ledgestone Drive—right to HELTMAN & TRIPP Builders and Developers of Westridge-of-Watertord 4192 LEDGESTONE DRIVE near Vatertere. Turn op Cambrook Model. Planned Kitchen Eases the Load — a ly “kite! hen’ storage pecs: | guests. * ° Studies show that the average ¢ Spruced up. household has food and supplies. enough to clutter all but the best of kitchens. If you were to make an inventory of your shelves, you'd’ probably find on hand 125 to 160 cans, packages and glasses of food- ttention because that ‘pecially the bathroom. stuffs. 85 to 100 knives, small uten- | VT bry Pontiac Lumber Co. .831 Oakland Ave. ome “ss f= an a PASS 4~ gr ACHE NGS 4 of the season Our Holiday Greetings to our friends come straight from the heart ... simple and with no false frills. May you enjoy a y truly Merry Christmas and a very Joyous New Year. D. E. MUNRO- Realtor “Wy J¥ \ “Twin Lakes Custom Home"— \ , v Pontiac's Greatest Value } o¥ 6690 Manson Dr. iy Waterford Twp. OR 3-4702 f 7 t a ba b) 3 “ 4 Pan = sils, pots and pans and 10 to 12) |different cleansers. Dishes and | glassware would add bugely y to ‘in the home. Spruce Up Entire House and Deck the Halls With Ivy A well-dressed, attractive home, | decorated with mistletoe, Knowing what you are planning holly and Christmas Tree, spells, for is the secret of well-planned a warm welcome to Yuletide! But for a sincere spirit of! | hospitality, the entire home should | In most homes, the living room! receives the major share of at) is wh guests spend most of their time. Other rooms are overlooked, es- | I Yet, bathroom is just as important to family entertaining as any room Jacluding the bathroom in a. —— ROY ANNETT, Inc. Realtors tion also give visitors the impres- |sion of a comfortable home. Such decorations wilt be appreci- ated for increasing the value of the home and providing lasting com- fort and convenience. Man is affected by 80 diseases) ) also common to animals. i - holiday decorating program is easy and relatively inexpensive. A few colored towels and towel racks wil) make the bathroom more pleasing. New paint or wallpaper on the walls, a “Mr. and Mrs.” medicine cabinet over a colored, countertop lavatory, or, a trosted glass enclosure | around a modern streamlined bathtub will add sparkle and , beauty. j * a * | Fresh bars of soap, clean mir-| | rors, adequate lig lighting and ventila- | Ph. FE 3-7199 ere | the ‘3:Bedroom these totals. | With these figures in mind, oak yourself some questions about your storage space: | Are all items stored where | they are first used? Crossing the room to get a mixing bow! or a | pan is just so much lost motion. Baking and salad supplies should | be at the mix center, pots and pans at the range, cleaning sup- plies and non-refrigerated vege- | tables and fruits at the sink, and | _ the toaster and waffle iron at the | serve center. Does your kitchen have work: |surfaces and base cabinet space, ‘at the sink, the range, the mix ‘and the serve centers? To improve jit you may have to add base cabi- nets. A good plan is to finish such cabinet tops with ceramic tile, so. jthat they will be waterproof and ; hot pots and pans will not damage | | the m. ‘ * * * Can you store some items else- |where? In a small kitchen, you can increase storage space by Gra dishes and glassware in |the dining area. Infrequently used items — the turkey roasting pan, the punch bowl and the pudding moulds — can go to the basement or the attic when not in use. * = * Are you using all the space| within the present cabinets? In many cupboards the space between | shelves is too great. Have shallow | expertly sharpened the use of precision ments. . and bevel, CRAFTS No Matter How You Look at It . . 1T TAKES AN EXPERT to sharpen your saws right! That's why we caution again and again to bring your saws to us. Every tool will be through you instru- Each saw tooth re- stored to its original pitch INCORPORATED 532 Union Street Phone FE 4-5139 Walled Lake | Area | WEST MAPLE RD. | | VETERANS FINANCING We're sending our Best | P | ” Closing Coats vl Wishes for a happy holiday ...and may nly] every good thing come your way! “Gan CONSTRUCTION CO. % OPEN SUNDAYS 12 NOON TO 4:00 P. M. * For Information Call: } COLWELL HOMES, INC. MI 6-2022 2260 Dixie Hwy.—North of Telegraph Rd., Pontiac ihe aly PHONE FE 2-1211 ta 9 en ha a fy shelves built between shelves for ————— such small items as cups, small! cans and glasses of food and, Spices. And use pull-out devices, | racks and files as much as pos- sible. Save Coffee Cans and SIDING instance, to set a quart paint can) 4C Greatest Value Ever Offered = "195 see oe ere It Pays.” Be warm on even wasted dollars today COMPLETE FHA 36 Months to Pay! No Money Down — $6.23 Monthly! the coldest days and Ce fuel bills by as much 40% Money caved in eoutty heat loss will the insulation of — just a few years. wait—start saving these / ACME INSULGLASS Co. 1698 S. TELEGRAPH In August Johnson Block FE 8-0488 Open Daily 9 to 6 — Sundays 9 to 5 SPECIAL DEAL ROOFING for Painting Chores } Empty coffee tins are hetptu D&M B DING aids to a home painter. } SERVICE You'll find it an advantage, for Phenes: FE 2-1006 er FE 2-815 ii! W. hope that you will enjoy this Christmas surrounded by all the things. dearest to your heart. And may the New Year jinto a coffee tin. Then, any over- —= side drips will be caught in the coffee tin, making it e asy to move, your paint can from place to place without getting paint on your hands. i? _ If you have purchased a pint. ,can of paint, you'll probably find, the top a little small when you dip your brush into the mixture. In this instance, mix your paint thor- oughly in its original container, | then pour it into the coffee tin to facilitate brush-dipping. After you have finished, pour the re- mainder of the paint back into its original can and recap it tightly. ‘Soft, Soapy Water Dries Clothes Softer Clothing laundered with soap in! soft water dries soft and fluffy to, & the touch. White things look snowy white, and colored fabrics retain their original brilliance of tone. Furthermore, soft water protects the moving parts of an automatic clothes washer against the clog- ging action of hard water scale. Home water softeners can be purchased outright at a cost that compares favorably with other {standard home appliances, or rent- | ed by the month from a water ‘softening service organization. Ac- cording to one expert, soap sav- ings alone will pay for as much Eves. & Sun. as 60 per cent of the cost of water FE 2-0278 ‘WHEN YOU HEAT-« HEATING EQUIPMENT THERE'S NOTHING FINER BURT! OTTO A. TRZOS 3101 Orchard Lake Rood | KEEGO HARBOR CALL MA 6-6247 | bring to you all the success and happiness that make for a rich and meaningful life From al All the BROKER A MEMBERS C the POnTIAG REAL ESTATE BOARD § os Annett, Bruce J. 6... 0.2... Ledd, Gordon G. “Rewtel, Davies Plains } 19-19 8. Perry St. ¢ nie You (CMeistmas § oy The lantern of welcome is al. ways shining for our friends... especially at this warm, friendly time of the year. Extended with it are our best wishes for a joyous Christmas end a happy New Year. PON TIAC PAINT MFG. co. FE 5-6184 | softening equipment. | gave His only begotten Seu, tiat ever believeth in Him shculd not but have everlasting life Kenncth G., HEMPSTEAD INSURANCE 102 BE. Huron St. “For God so loved the World that | Wishing You the Peace That aoe Can Provide at Christmas and All the Year Ph. 4-8284 Annett, Roy ........ ese eee one 28 E. Huron Bartram, Horry L. Box 381, Dreyton Plains -, Bateman & Kampsen 377 S. Telegraph | : Beaumont, Harry S.. 3500 Duck Lake Rd., Milford Levender, Dorothy Snyder ......3140 W. Huron Loveland, Jack .. .Box 642, Keego Harbor Mahon, Q. R. 1075 W. Huron Marble, George 6261 Andersonville Rd., Waterford GET YOUR— % COPING % WINDOW AND DOOR & CONCRETE STEPS % STEPPING STONES * SPLASH BLOCKS & CHIMNEY CAPS *... AND CUSTOM CON- CRETE PRODUCTS FROM us! Custom Mote Wrought Iron Railings for Your Steps 54 W. Sheffield off Baldwin | ; Telephones: FE 4-5143—OR 3-9741 FOR WORK MEASURING UP | TO YOUR REQUIREMENTS PONTIAC PRECAST | - Bird, Carl W.. . .503 Community Nat. Bank Bidg. Martin, Nine. .... 412 Main St., Rochester | Borst, Lovis ............. ..26%2 W. Huron Meagher, E. T. ..... 289 Tanview Blvd., Oxford ot He ge Brews, HW. .... 8.8. 1362 W. Huron Millis, John ....... 6... 43'2 N. Saginew perish, . Bull, Russell... .2383 Orchard Loke Rd. Nott, Russell «ww 170 W. Pike fohn 3:16 Chorles, B.D. ............ 1717 S. Telegraph O'Neill, Raymond ............ 75% W. Huron ; Clark, Cameron .............. 1362 W. Huron Partridge, Ward E......... Aa O 43 W. Huron - Cowe, John .......... 1308 Pontiac State Bank Pontioc Realty Co. .............. 737 Baldwin 2 Crawford, Ernest R............ 532 W. Huron Porritt, Carrol ............... 262 W. Huron -. Dalley, Jos. R. ........ .914 Pontiec Bank Bidg. Reisz, Joseph F. .............. 53% W. Huron Dorris, Roy A. ................ 752 W. Huron Roach, Dick ...1102 E. Maple Rd.; Walled Lake Elwood, Thelma ....... 5143 Cass-Elizebeth Rd. Seales, Geo. L...... 2.2.2... 8612 N. Saginaw Gaylord, Lawrence .............. 136 E. Pike Schram, Iven ................ TIT1 Joslyn Rd. Green, Walter M. ....66 Park Bivd., Lake Orion Smith, P. T. ........ 1536 E. Auburn, Rochester Hammond, Paul ............ 2642 W. Huron Smith, Rolfe H. ................. 28 E. Huron ce oe ba on 86 vee a Wee Stout, E. M., Sr. .............. 77 N. Saginaw empstecd, Kenneth ........... . Huron Humphries, Lewis 0.0... 83 N. Telegraph eee camneth 7 ‘oa30 on we ae. Humphries, Dorothy G, ........ 83 N. Telegraph : 4 a Irwin, George ..............269 Baldwin Ave, Tripp, Leslie. ..............22 W. Lawrence Irwin, John K..............101%2 N. Saginaw j§ Veluet, Richerd ......... - 345 Ockland Johnson, August .......... 1704 S. Telegraph Waddell, John Q.. 501 Comm: Net. Bank Bldg. Jones, Leslie ..... pease en cee seh a us Rochester Watson, Maurice .... ..428 W. Fourth, Rochester Kennedy, Wm. A. ............ 3097. W. Huron Webster,C. A. .......... 18 Broadway, Oxford Kent, Floyd ................24 W. Lewrence | White, Robt. C. .. . .5660 Dixie Hwy., Waterford Kern, PawlA. ............ : -11% N. Saginaw Wood, Charles A.. .1725 Williams Lk. Rd., Re. 2 Kinsler, John ............5..00.5 .670 W. Huron Wright, James ...............,. 345 Ooklend eeu nd beeeee cscs ee 26¥2 W, Huron Whitcomb, Wm. . . .3445 South Adams Rd. ++. 510 Pontiag State Bonk Young, Russell. ...............412 W. Heron, \ a ; I « . of \ y = i hy | 7 eu 3 s THE PONTIAC PRESS, SATU RDAY, ‘DEC EMBER 24, 1955 Rend Fver uml Threatens US. __ TWENTY-SEVEN At the holiday season we if They're Abused Be fussy with household drugs or rejoice in the knowledge that i be fatal with you. the old-time spirit of friendliness jing remadeling and cooperation is still a warm ; } You'll be reading stories about powder by your baby, for instance, can cause beri trouble, The one only way to prevent i; a house, You'll be seeing countless — uverine ergs and other household preparations is to keep housing areas can be given NeWiiom in a safe place, out of the \life, mew beauty, new livability reach of children and so marked i with the aid of imagination ‘|that adults cannot mistake their fond energy. | ee identity. Before know it, you'll be} Beside the danger to family getting om ite, vou be members, drugs and chemicals _ Teality in our daily life. Your genine contribution to that spirit is really appreciated. May al! the happiness of ; p*Merry Christmas” -»- in these two old-time Christmases not only a looking with ques-|/ften cause permanent stains on} words we wish te fravtlbapaclagelr peeane Gud Teen tered or kitchen (partacre Aad abe W, want all 6f you express our appre- ismall, at~closets that are too|only sure way to prevent this is to - be yours at this season ciation for your (crowded and at kitchens that arejhave your wails, floors or counter- wonderful people your Bi outdated. tops in bath and kitchen surfaced but also through out a unwavering good- with a permanently stainproof ma- ie . | The whole housing industry terial such as ceramic tile which fo enjdy the very will and friendship, is going to be at service | an be cleaned with just a damp Prosperous new year. ot yes & re cloth. best of Holidays! Prime of Paregacroare: If a particular drug prescription jmagic, of rse, is that does not have a future use, throw substance known as paint. With it out when the need has passed. If. _ AUGUST JOHNSON Fred W Moote PONTIAC CUT STON E /paint, you can work a major trans-\Jabels are loose, secure them with, Realtor . M-59 (V2 Mi. West of Airport) Ph. OR 3-1594 formation in the appearance of/tape; if the label is lost or illegible, ja room — or the outside ot @/diseard the container. house —more qruiekly- than with any other device. With it, you can bring] The Great Lakes have an esti- 1704 TELEGRAPH RD. FE deral 4-2533 OPEN SUNDAY |! TO 5 Electrical Service — | about greater en amare ce, mate 95,000 square ‘miles of ace cea oe ‘Actually, youl ——~ IT’S COLD BOND AT BURMEISTER’S .. . IT’S COLD BOND AT BURMEISTER’S jean paint the walls, ceiling a = br Seeceatt ieee 6A NewR . se ="J erewer|? A New Room ; Ses, BREWER 33 : E | ese Broker 5 | | The Front Porch | } compete nest tstate Services | |an s 8 . —w 8 Is Extra Room inish Your Attic y BET ae When Necessary < * |) 8 co ccpenteg soar woes aay Be FE 4.5181 S Do this at Burmeister’s—just sign your F iz “right at your own front door. Q name...no money down... low monthly < _ The tont porch that ive mmr) TO BUY OR SELL |, Payments . . . Best of all, you buy at the “4 4 time can be put to work the year] © REAL ESTATE = | price. e around for far less than you could S — (4 home. ite rest is there, ond ip 4 FOHN KINZLER ' ~ rangle > [ioundation, A@er a closing-inll gro yrenron © oUneee clin _ Here Are Some of the Buys in This Huge = operation, it is apeaat/ = - % moceiseen = vce |. $100,000 INVENTORY REDUCTION SALE 2 lidren or @ m. | 3 | mes 1, though “AW. Realty” w Best Wishes to Our Friends [ape a ery ae | THELMA M. ELWOOD ! . All Merchandise Must Be Sold and Delivered by December 30! . for a Happy Holiday! ev elear Hen of te cot ot te mt.grame ce | Open Daily 8 A. M. to 8 P. M.-Monday, December 26, 10 A. M. to3 P.M. - project + men - ° lomteas 7 | Seats ta gee tas ow reef : 50,000 Sq. Ft. Gold Bond 5 ustin-Norve _ more wetness catureall A 2 A best Sidi NE MILLION FEET uv a Pemicties | g Asbestos siding | AEE LUMBER MUST G0!| 3 verted to year-round living. Built-| ins take up less space than storage => 7 Beautiful Colors | Agen¢ y, Inc. umits do jan if you think through jo Both Dork Colors and Pastels e . ° your needs carefully you # B D i Reg. $150 $118 525 the built- = ee exactly ‘to! te Regular $14 95 2x4-8 | & tr.-D. F Vo..... NOW per M o 7 ts f our specific Ss. hd “~ oP sr 8 n 2x4-10t0 16 =1& Bir-DFir. se, $123 | 2 h r may 10 sew | x a Reg. $150 ee Se d wow $4] 795 /petuucreman: SE: my ssons in . Je i) 0 r = r eg. . + ma do o"ive + NOW M hen ee 9 210-8 to 16 #1 & Bir-D. Fir 352% $123 | = eae ve gril or a broiler will) ee | Gold Bond siding is a product of | . <= = come in very handy. ='/s Heat aos reason come 4x8x5¢ Fir Plyscore ..... . se $5.49] 2 —— ° ne not ale) = ' Sprihatic Foor Covering | | Steen, =e 1x6-*2 & Bir. Pine Bds..... cu 5', $108 4 Marks Newer Features oder IE . 1x8-*2 & Bir. Pine Bds,.... . 5% 3°, = $108 and nw caps ati] Ao erie =|- Gold Bond Masonite 4x8x'4 Fir Plywood........ we $3.95] & s . In cur- ) retains, more decorative —|. 4x,8x' Std. Sheet $2.45 | 2°x8’ Exterior Sheeting Sheet 98] - carpets and sei Hed ae af ven Brechin @ e . gymnasium of Stanford University Dick & Wes’ club faces Walled eft to play. | “He was sloppy and he made/20 Paul. hb 7 Soe _ N ot Compete 1n Olympics as the school was alerted yester. | ake in the 2nd tilt at 9:30 and| Vanderbilt was the only other me sloppy, too,” Ryff added. “Tine — = 2 fs moe hb day to provide housing for 5,000 carat aie Se ee an | oan omnes oe tires » owe oe HB BBE wanted to give the fans a fight 50,2 Renfro, no 38 Burroughs bs "jin the nightcap at \ tion and the eighth-ranked Commo- oan f 7 31 Morris e-f> NEW YORK ® — Veteran bob-|bobsled champion, succeeded Don-/Storm refugees. | Nestor’s All-Stars, who drew adores were knocked off by Iowa) DUNKING DON—Bill Russell, taues ee et ee Ide. ¢ Modasiewat ™ 33 Younger fp sledder Stanley Benham remained|na Fox, longtime vice-president of “We're about where I figured 1st-round bye, complete the tourna- State 87-76 in the upset of the) 610 star of the San Franisco Gidedilts shag when |T could: 40 Jones be 40 Hirsch « barred from internationa) competi-|the International Body, Fox fig-| we'd be,” he said “We got in ment's seven-team field. The dou- | night. It was Vandy’s first setback | Dons dunks the ball through the Charlie Black, Ryff's m a its Fettibon | hb 41 Come b - tion today and is not expected to|ured prominently in the ban on 9 tittle outdoors stuff yesterday ible-elimination tourney continues 'after six triumphs. | Rove. ie weat 6 an ooty Sot Oe, said he wanted matches with 32 Palumbo ¢ ey aeedy pd compete in the winter Olympics at|Benham. ‘and I think the time can be ‘Tough Saturday, Dec. 31, with Illinois, No. 17, built up a 21-1) him. Russell is leading the Dons Light weight Chatipion Bod Smith |e! atak is Melenghiia < 5 nter- | jthree more games carded next lead against Oklahoma and to one of the most fabulous rec- ‘ls Bardley ¢ 87 Griffin c fe Benham was banned from inter g ortina, Italy, next month. | spent in learning assignments : aa a! a ex-Champ Jimmy Carter or any s2 Forester ¢ 60 Ellena ¢ > * ® national competition last January) inside just as well as outd pai sday. breezed in 82-58. The Sooners did ords in cage history. l ther moc fighter. Ryff weighed 6 Otbren 6 ¢i Pumem ¢ The appointment of William J. for what was described as “un. _ _ | —— - - Fm — i138 coupe Vasquel 126 ($3 Noll «2 McFadin t Linney of Port Henry, N.Y. to the sportsmanlike conduct.” | East squad members will be’ . e Judge Artie Schwartz scored it (74 McCormick 65 Hauser t International Bobsled Federation bd given a five-minute shot at the| ( : S11, Judee Artic AS dala 64 is ad eendusky | -al ae c Friday led to conjecture that Ben-- The U.S. Olympic Bobsled Com. telephone tonight to wish the folks al ans an f UINS a e 0 | a (we referee Ruby Goldstein 5-32 all for % Ford, , it Puller @. ham's suspension would be lifted. |mittee stood firmly behind Ben-/back home a Merry Christmas. Ryff. The AP card found for Ryff 83 Weber 1 pe Dan Ferris, executive secretary ham, — claimed be pulled out of | - ” a Cc “h Red Sa di = I ased his ‘ d hi ” Sa de = id 7-2-1. The crowd of no more than $s vp iteleal ‘ i J eahonen t of Amateur Athletic Union, said, the world four-man championships SMU Coach Interested By ROBERT FE. VOGES | Coac Sanders releas his tired at this stage. nders said. 1 599 (no figures were announced) #8 Brewiter (¢ 80 Fears ¢ however, that ‘Benham is suspend- in Italy in 1954 because he couldn't ed for three years and that sus-|transport his own sled to Europe. pension stands. This matter is un- derstood and Benham is not plan- |disq ning to compete in the winter|team unless the U.S, committee terested in “any head coaching | The ualify the entire American games. The games begin Jan. 26./Changed its position. * * * ithe American team, In March, Benham resigned from ‘pect for the coaching post at Wake| iForest University, said today he was in-| College. of PASADENA, Calif. 5 DALLAS «®—Bo Hagan, back-,UCLA football squad was home eleven man against eleven scrim-| ; IBF thereupon threatened to field coach of Southern Methodist for the holida ae Ct Ce) Ce Michigan State Rose Bowl entry remained at its swank Pasadena; Sanders said \job" when mentioned as a pros-Hotel headquarters, alternating would be his last before the game.) The Bruin coach said he was practices with a packed program! “The team is a little tired right u — The players until Monday after a stiff [ye been awfully pleased with/took the decision in stride. | #2 Boyd ae eeeeneneeeneeeeneeee | 84 Robiustelll e ys today while the mage yesterday morning. eae id the Babe Leaves Sick ibeginning. They’ the scrimmage hard.” ve worked real Young Angler Hooks 29 Inch Christmas ~ activities. eS ees See vn Walleyed Pike Linney, a former National AAU Mantle Wins AL Slugging Crown Yankee Slugger Ahead of Detroit's Al Kaline in Total Bases NEW YORK i—Mickey Mantle of the New York Yankees, the American League home run king last season, also won the circuit's slugging title, the official average showed today. : Mantle was an easy winner. He pounded out 316 total bases in 517 times at bat for a slugging mark of .611. Detroit's Al Kaline, who finished on top in the batting com- petition, was runner-up to Mantle with a ; si by dividing the total bases on all hits by the number of official trips to the plate, Ted Williams of the Boston Red Sox also distinguished himself in the slugging records. He wound .up with a sizzling .703 mark, but was ineligible for the crown since he struck out 97 times in 1955. Norm Zalchin of the Red Sox fanned the 1 Be | t C) inow, but they’re supposed to be cress made by guards Don Birren| Bed for Holiday Warnecke caught moe laa Esker Harris, declaring, James the GALVESTON, Tex. #—Sporting ‘they're much better football play-|largest fish of his young career her first new permanent wave in lers now than they were at the end Friday morning in Lotus Lake. eight months, Babe Didrickson ‘of the season.”’ | Jim, 14-year-old son of Mr. and Zaharias was to fly today to Fort * * ‘Mrs. Donald Warnecke, 4159 Win- Worth for a three-day Christmas After a free morning, when most diate near Waterford, landed a holiday. iof the Spartan players either slept|Walleyed pike yesterday while fish-- The famous golfer, who had been late or caught up with last-minute|ing through the ice. The husky in a Galveston hospital for a phys- shopping, MSU went back to work Specimen scaled better than four ical checkup, said she would ap- ‘on the practice field. pounds and measured 29 inches in pear at, but would not play in, The team will have its private length. ian exhibition golf match at Hous- Christmas party tonight and Sun- The youthful angler. who was ton next Wednesday for the bene- day will attend a Tournament of trying his luck with a chub, fit of a cancer fund. Jimmy De- Roses Christmas blowout. jnabbed the fish after 15 minutes maret and Ben Hogan will play Coach Duffy Daugherty varied of effort. He was alone at the against Jack Burke and Jackson his practice routine a little Friday | time. Bradley in the benefit match. afternoon by first drilling the en- OO : ~ micing or erera cronies MSU Students to Begin California Trip Monday tactics for the entire outfit. All-America quarterback Earl Morrall was nailing his ends. nicely in the pass drill. a EAST LANSING, Mich. —)return Jan. 5 in time for winter Summing up the past week of/when some 2,700 Michigan State|term registration. practices, Daugherty said he was University students take off Mon- | MSU officials, gathering experi- particularly pleased with the pro z ‘ence from their 1953 Rose Bowl ‘ gress made by halfback Clarence /‘ay for the Rose Bow! festivities| trip winl-place seven adults aboard Peaks. in California, it will be the largest each train, including a clergyman “Peaks is at his best form since peace-time, non-military point-to- and a registered nurse. The uni- he was hurt in the Notre Dame point mass movement by train in versity calls the adults advisers, game,’* Daugherty said. history. |not chaperones. 3 T ———————————— | So say representatives of 11 ma- Standard campus behavior rules © : | ‘jor railroads who pooled equip- including those against drinking, ( Basketball Results ment to provide modern, _light-|will be enforced on the trains. Co. weight cars for the six student eds will outnumber the men, special trains. | The most popular student trip Q ‘ Francisco #1, N. Orleans Loyola @ ‘ Spring Hill (Ata) 63. Wash, State 60 i ae : 1 State 87, Vanderbilt Another 1,800 students will trav-/package costs ‘$170.90, including | RIVAL ROSE BOWL i weeks me ©. dena accommodations in eight downtown SCORE — Coaches Red Sanders (left) of UCLA and Dutty Daugh- ‘meet under more: seriods circumstances Jan. 2, They spent the | Qtiahema Aait %e. Buylor ftv so Satin te Spartan Sootell sonn|leey Angus hentia Clots ena Sent erty (right) of Michigan State are joined by their respective wives evenirig together last night at the home of & miitual friend. The Oniahome, City 0. Tose hrietion 64 play UCLA on Jan, 2. _ |students will be quartered on ee ep . Filial As se St. Francis (Bkn) #7, Queens (NY) 63 é , , \ The trains will leave Monday ahd|arate floors, ors \, * Seca Duoet ~ siete, cera Meta) them Nha ak en en ere ess et MMH ey te Pa ect) Se ~ i mena Ye rar a oe: myc sae Lh Tena 4 = z i ‘ x . 5 THIRTY | M THE PONTIAC PRESS, SATURDAY, DECEMBER 24, 1955 ‘ . +s ir si . Now there’ ~ [NICK HALIDAY | By Keats Petree Traimmen Visit [Meter christmas in store tor te BUlIdozer Used = F * dl W (big family, tiving mainly on wel-'to Clear Snow Ben aya Papen W OF _4 rien y avers fare since ~~ ee ; war Os FOR --E With Yule Gifts Nenwsan't wok From ‘Runway = *. - AT HE WANTS VASSAR, Mich. u—Chesapeake, CHAPPAQUA, ae nie bull- Af : ; Sa vinaw-! doz o tor clear emer- ' to tinmen oo te See Clever Patrolman ese, ‘esr Sete, Sen) i ago with a couple of youngsters liv- gee |plane caught in a heavy snowstorm ing close by the tracks here. Keeps Feet Cozy Tewreany: As the friendship grew, they be-| . : | = - = gan tossing candy and gum to the’ UNION, N. J. wm — Patrolman! Angelo Coluccini, 56, of York- children, who appeared to have Fred Hrasne's ingenuity keeps his;town, operating a bulldozer on a few luxuries, \feet warm as toast even when high school construction project s. ¢ * the mercury plunges below the/near here, saw the single-engine With Christmas approaching, freezing mark. {Plane circle over the field and re-| brakeman H, Robert Ormsby The. traffic officer, often plagued #!!zed it was in trouble’ | thought it would be nice to round by numbed toes, decided to do! He quickly scratched out in thé up a few gifts for the kids, Other something about it. snow “Okay land here’ and pushed ‘Saal and outsiders joined with He placed a construction flare ae Sie Saeco im. in a small hole in the nd and, a The other day he and others covered it with a fetal (plate to of anew The plane then landed! A drove to the home of Mitchell eel person - It takes about are we 4 4 oO, husan in a station wagon and auto wort gasoline to provide four! . loaded with food, clothing, toys’ days of foot warmth. tes erred ee ee and other gifts. » | And as the snow came down dent of Helio Aircraft Co,’ By a Christmas tree trimmed yesterday, Hrasne said: . only with crude, home-made dec-. “My feet are comfortable for; New York City is 36 niles long orations, the presents were turned the first time in five years on the and about 16'2 miles across at its over to Neahusan, his wife and’ force.” {point of maximum width. _ BOARDING HOUSE fy jypjleii L224 FORD! TAKES SO LITTLE To ZANERE'S YOUR CoAT, LA BRING SO MUCH JOY TO SO MANY AA SANTY/ AND DONT {~~ HAR-RUMPH/F AS MAHATMA Z\ TELL THOSE Kids At JA GANDHI ONCE TOLD ME ~ OR = \ THE ORPHANAGE LAWAS IT OLIVER WENDELL pot THE KP YOL) CAME DOWN THE \\HOLMES Z~ANYWAY,HE /7 SACK'S ALL CHIMNEY YOU'D GET \¥ GAID—-AH-ER=~NO 4 READY, KRIS! Bes GTUCK GOING THROUGH | \ONEAKING A PEEK \’\ T HOPE MY AT PRESENTS | > OLD 1%4- CAR ARCH OF (3 REINDEER- » TRIUMPH! LLEY 00 by T. Y. Hamlin ' ‘ c d 3 f Y) a wi . v/ re YQ WRI = DP eser caet oy chk poe 1. M. Rag. U. 8. Pat Off. By Ernie Bushmilier FOLLOW = Mwro NANCY POWER JALOPY THIS foaeas STRING , TONIGHT ATUL ELLER DO re Gegeettentente UV) ; UW, “-_—_"~_— . TT CO) yun 8BUSHM1LLER— CAPTAIN EASY | by Leshe Turner YOU WANT THOSE HERE'S ONE FROM YOUR SYNDICATE Y YOU'RE RIGHT] [ THATS THE SPIRIT! 115 \ THERE 1S ONE STRIPS REPRINTED URGING YOU TO REPLY! IT SAYS / HONEY! 1 MUST] | WORTH MISSING ONE } SILVER LINING! THEY ASSUME YOu'RE STILL ALIVE | GET OFF THAT! | DEADLINE I WE CAN YOU SAID I MUST SINCE YOUR SIKIPS KEEP COMING | REPLY IF IT | LWHIP YOUR PHOBIA P oe UHE SAME TO YOU = 'T GO / EXPLAIN IT; 12-24 Cope. 1905 v7 wis Service, tne. TM. Reg. U. 8. Pat OF aaah OUT OUR WAY BOOTS AND HER BUDDIES by Edgar Martin : aK Wowk OF || THIS ISN'T THE PLACE | OUST WAIT TLL YUE SEEW A LOOK OF MORE Px | THAT, OR TIME... CERTAWLY | HEY... TLL CHRISTMAS CHEER OW THE WELL, ELLIE. So You've ||] ADA! WOT THE DAY...FOR YOU'VE GOWE, | *f# FACE OF A DRAGON AFTER PWALLY CONDESCENDED | WEURY. Jo RETURD! piles WELCOME MELLO! nome! A y ~, Sey = . IC Lod ; ( ; = Ew Pa ¢ = ‘td na heal —" Natanieior in rt | ee \ — ", i elt, an —— Vidi 12-24 * , 4 ~~) th Uy —r—S - a _ sy é v aw et ~ oO Copr. 1955 by NEA Service, Ine. (ots vee JR wittiams 12-24 SSS *CRANDIVIA a HEROES ARE MADE -NOT BORN weet neatices a | - " - (WISH COULD ) | [WELL GOLLY, | GOTTA : wy, DIXIE DUGAN ‘ ) REMEMBER | |GET INABITOCOASTIN FE «(| WIPRE-E a \ ‘By McEvoy and Strieber | WHO BORROWED YES, MISS LUNARD) >> - é MY SLED LAST. ss. ENS < “| en Pe A : Sve = “pp 4 4 Z Y TO LEAVE AGLA OF MILK AND SOME. COOKIES FOR SANTA!) VL {& -DO IT YOURSELF 4/ZerKiuer- [ADIUSTMENTS rin — “ar 3 —j A \ 4 \/, BONE DRY... AND 17'S Eonar St { JUST BE GLAD mgt TBROUGHT AN: \gemme UMBRELLA! / 7m if egy MA Field Eoverprem. tee | ' ~ “I betcha. you're sitting there just wishing I was a boy!” | es ree Fe error ata lpiaghobocauiaetcs aoe plete ahem Demet ei \ Loe i i if : “< «sige ‘i sieiiaaesone hi ‘ Rea On |e Ae ieee tee eee ieee fs THE PONTIAC PRESS. SATURDAY, DECEMBER 24, 1955 Carmakers to Miss | ‘Target’ by 32,000 DETROIT (® — The auto in- dustry’s 1955 car output will fall, about 32.000 units short of the i coveted eight million mark, Ward's! Yule Business . |-- Tops ‘54 Mark Whole Nation Reports Increase in Christmas Automotive Reports said yester- Shopping Activity . ay. sss The shortage will result, it add. NEW YORK \ — Christmas ed, from the elimination of over shopping in the nation’s retail time almost generally throughout stores reached its 1955 climax this the industry. week with gains reported from one | end—of the country to the other A Dun & Bradstreet survey, showed yesterday. @ G e The agency estimates this week's total car output at 154,- 593 units, compared: with 168,- 256 last week, and 124,854 in the like 1954 week, This week's truck output will come to 20,065, com- pared with 27,166 the preceding week and 138,653 in the compar- able 1954 week. Ward's said dealers now hold ap-' \Proximately a 35-day supply of! (cars, compared with a 16-day ‘stock at the same time in 1954. * * a Total doilar volume was notice- able higher than the boom levels of a year ago and somewhat bet- ter than ‘the king-sized business! scored the week before. Shoppers! were particularly interested in, household gifts, toys and children's | clothing. Along with the rise in! gift merchandise, auto dealers re-| ported a slight increase in sales of new and used cars this week. * * * CHARLES G. ULIGIAN Furniture Firm Names Manager ..’ Chet oes eel ae aac 1,201 trucks. compared with 6,38?! on vate m chiens ap _._, cars and 1,064 trucks last we>k and parel Include Doys coats and’ promotion of Charles G. Uligian 4880 cars and 979 trucks in the footwear, and girls’ dresses and to the position of manager of hte! comparable 1954 week snow suits. Shoppers also concen- Thomas Economy Furniture Co... __ e 8 ¢ trated on hosiery, lingerie and 361 S. Saginaw St., was arncamced | It places U. S. car output to handbags. Meanwhile, furniture re-'today by President William D./date at 7.839.592 units compared tailers chalked up substantial gains Thomas Jr | with 5,385,140 in the comparable = occasional chairs and uphol-| Associated with the firm since) 1954 period. stered ming Fuom eres 11950, Uligian formerly was adver-' itising manager. and has served as head of various departments. Research Club Party County Deaths Grace Allen LAPEER Service for Grace Allen, 87, of Metamora Total retail volume for the week ended Wednesday ranged from 3) to 7 per. cent higher than in the. like week of last year, Dun &! Bradstreet estimated. Al areas did better than a with percentage gains as follows: iger of the Singer Sewing New England, unchanged to up'Co.'s Pontiac office ° 4; East and Pacific Coast, up 2 to 6: South and Northwest. up 4 to 8: Midwet and Southwest, up 3 to 7. the new manager was for two held its Christmas party this week. “ch. N = years a district manager for the with Mrs. Wesley Mahaffy, Mrs. Church, Metamora. ‘Ave. U. S. ‘Operation Candy Drop’ Invades Sparkling Deco West Germany in Support of Santa Claus for Christmas WASHINGTON (INS) piiebhed lle pormeany (B—"A $14,200 to aid nearly 3.700 orphans,' Europe, said in a message to-his White House is all ready s 2 a S face is the same refuce : ae A a inl any! langunse jrefugee children and physically troops: One GI summed it up that way handicapped youngsters | 2 * * “During this season we are far, room, today as American servicemen ATTEND CHURC : ho before the last four trading days {rem the Atlantic to the Iron Cur-' The 4th aan Div from our homes. This is but one of | EES Ewvited to see the dec-- oy the year. It takes four days to 69 stocks this week gained $1.10 tain took time out from their po onye aniry Division in) the many sacrifices we must make rations found: deliver a stock under the rules of aNd closed at $179.70. It will be re- Christmas celebrations to brighten 'Tnkfurt bought toys. clothing as we stand on the frontiers of An 18-foot spruce sparkling | the New York Stock Exchange, Called that the average ° reached the holiday for thousands of or- 89d food for 1.500 children and democracy. amis here that we de- phans, needy children and refu- 88ed needy persons. end aod meinen Jetoetd for our; the poinsetta gees. Virtually every U.S. unit sta-, For many overseas Gls, Christ-| country and) for thee of good will (_ccom: tioned in Europe gave a party for, mas would be observed much the| . | aren or help of some kind to same as back home — attending Earnings ithe Green Room. * fo i . mee | silver and blue-bul Christmas Eve parties, church; YORK (INS) — Carrier glowing in the Blue ‘pea has announced net income Pink poinsettas giving acce * * "E-ser In Germany. where the bulk of services and a Christmas Day'corn the 300,000 U.S. servicemen on the turkey dinner. The Army promised for the fiscal year ended Oct. 31 the Red Room. oped lad Bee Se nearly a pound of turkey per man Of $8,487,220, equal to $4.82 a com- eainated 70 000 German children ©? 4 inner that starts with shrimp me mete) This compared (wah sani ae 8,515,089. or $4.81 a common ,. : e i _ cocktail and finishes wih min $ be ' - were enter tained at pre-Christmas ny a s wih ce share, in tbe preceding year. Sales ting off the long table in the festivities * * ee declined to $190.015.233 from $200,- “Dining Room. ‘CANDY DROP’ The army also arranged to get 916,391 the year previous; however. Reporters also discovered WINS WESTSIDE HONORS — Santa Claus and a team of miniature reindeers pause in front of the hom eof the Glenn W. Richmond family, 334 Voorheis Rd. The display, conceived and ar- Mrs. , will Before joining Thomas Economy.) MARLETTE—The Research Club P¢ held at 2 p.m. Tuesday at the Metamora Pilgrim Congregational Burial will be major Florence Stove Co. of Gardner, George Pringle was in charge of '" Metamora Cemetery. She died ket approached the end of the year @Z0, Mass. Prior to that he was mana- the program and Mrs. Lee Wilson ‘MS Morning at her home. The year this week with considerable Machine told the Mexican story entitled body. to be at the family home spirit and gave high hopes to the ¥ at 4118 School St. after 4 p.m. bulls that 1955 would bow out with — — White House | Gets r The- selfing to establish profits and ‘mas, and that should set the stage for ‘Christmas with a glowing tree or holder ‘holiday flowers in every public it for with white candies and tinsel in - decorated East nt to tree White poinsettas giving dash to A big bowl of red carnations : rome of Mrs. amd two small artificial trees set-' es . State that on Oct. 31 increased something “old” has been add- | 5 ranged by the for Year-end «By RADER WINGET NEW YORK, (®—The Stock Mar- In years past, there has been a strong market in the final days of the year, and brokers saw noth- ing now standing in the way of a repetition in 1955. How far such a rally would carry into 1956 was another question altogether. One cause for the final rally is losses for tax purposes. A stock- with a profit can register 1955 by selling any time and profits aren't establish Marlette Clubs — Hold Parties for Christmas MARLETTE—The held its Christmas meeting at the Phillip Mutch. Mrs. 4 Joe Nixon conducted the business meeting and it was voted to send money to ‘Save the Children Fed- eration’ Gifts were exchanged. Mrs. Ward Hendricks and Mrs. Robert, 15, won first place in the western divi- | : . sion of Thursday's Junior Chamber of Commerce home deécoration contest. B ullson Market Have Hope Altrusa Club THIRTY-ONE ike, Mamie Will Hear [a . Grandchildren’s Carols Jail Inmates lo Dine ' ° WASHINGTON (B® — Christmas ()f] Chicken for Yule carols, as sung by their grand-' children, will start President and| heart in sel apres County —_ a ‘ir way to. Jail will be treated to chicken din- Mrs. Eisenhower on their way Use eee (ab Chile ad SRCA Fecs Irons said yesterday. Trusties, who work around the ‘jail, will dine on roast chicken The three children’ of Maj. John hee Se ea, Fomwh Eisenhower, the President's son, leno do no work, will get creamed jhave been practicing for days the cricken without stuffing, cranberry ‘carols they will sing for their sauce or roast potatoes. grandparents, their father and Salvation Army authorities said their great-grandmother, Mrs. yesterday they planned free din- John Sheldon Doud of Denver, who ners for needy residents and tran- arrived this week. ‘sients in a local restaurant. jnight to a cheerful, old-fashioned family celebration at the White | House. * * * Gotham Yule in Frenzy Past Matrons Set Party NEW YORK (INS)—The holiday) METAMORA — The Metamora spirit reached a frenzied peak in Past Matrons' Club of the Eastern lew York today as shoppers and Star will hold its annual Christmas travelers mobbed overburdened party at the home of Mrs. Edward stores, rail and air terminals in/Dubey Sr. at 8 p.m. Wednesday, an effort to complete last-minute/Dec. 28. There will be no further Yuletide plans. |meetings of the club until April. *Poutiac Press Paotes Richmonds’ sons Kenneth, 17, and b SGQGe \ SY N WY NN Stock Rally *® \ : ra tk dtr ee | JOVEUL |W buyer. All such selling was out | of the way this week. During the final four sessions this year, however, sales can be made: to establish losses which are reg- istered at the time of the sale rather than at the time of delivery. That means that for tax purposes only stocks with losses will be sold. | And, it was pointed out, there aren't too many losers right now. , Therefore, the pressure of tax selling is expected to ease off to the vanishing point after Christ- Wth the keenest appreciation of your good will and patronage we send you our merriest Holi- day wishes. MALLOY’S : 5.N. Saginaw for a rally, brokers figure. AIRCRAFTS LEAD The Associated Press average of its record high mark Sept. 23 and ‘then plunged down severly in the big break following news of the um —— President's illness. On Dec. 5 and) wamneeooee nec ces 6 the average again was at that old record high figure marking the completion of the Eisenhower cardiac reaction. Several times the average has attempted to force through to a new record high without success. DB wD. Aircraft stocks were among the most favored equities this week because of expanded de- | fense spending estimates, Their | strength eventually drew profit- One of the warmest gestures was h0t turkey dinners to troops in unfilled orders “Operation Candy Drop.” The 14th the field or units manning isolaed to $48,205.2: Armored Regiment sent aut mo-\"adar and commumicaions _ sta- year earlier. torized Santa Claus patrols to, Uons. | our West German villages border-- From American military ing the Communist frontier and in Europe came message of greet- deliver candy to children. As the) ings to their commands. patrols entered each village, the [G GI Santa called the kids to birt) eee case by loudspeaker. Elsewhere, Santa ‘arrived by. jeep, by “sleds” built over jeeps and by helicopter. One outfit in Germany dropped toys to children b¥ small perachutes. These included one from. Adm. |$21.757,928, Southern NATO chief. who told his forces: Among typical Christmas under-) preserving peace and freedom in takings were these: |the world.” Gen. Anthony Slugging phans. | At Wurzburg, Germany, the 10th U.S. Infantry Division collected) About §20 worth of Christmas. UH!—T_“=_eee presents were stolen from her un- leaders _ NEW YORK (INS) — Southern’ engraved there by President swered with a Christmas recita- ! the week. Railway Co. reported net income, John Adams in 1800, jfor the 11 months ended Nov. 30 of| $33,197,803, equal to $11.72 a com-).. ‘mon share. This compared with Frankli or $7.32 a William M. Fechteler in Naples, share, in the same period last commander-in- vear. Gross revenues increased to '$252,557,384 from $226,364.821 in the “I am deeply grateful for your 1954 period. November net income important contribution in the past €8mounted to $3,146.605 as against! ‘year toward the NATO mission of $2.867.115 a year ago. c. scaunte, PONtiIac Man Admits William F. Smith, 29, who told ‘from $39,104,469. ai ed to the mantel over the dining | Larry Chappel were in charge of | Toom. fire; — The “House the program, Christmas carols taking, and they started dropping r | Blessing” which was originally were sung and roll call was an- back one at a time by the énd tion. It was voted to use this The move by the railroads to get: . sans year’s money for the recreation a half billion dollars a year in Somehow, the inscription .g ot park. higher freight charges helped the banquet room of Teale’s carner generally, but they were Cafe, was the meeting place under selling pressure as the week for the Philomathean Christmas closed. y. Each member was pre) The five most active issues this sented with a corsage. Christ. pes on the New York Stock Ex- mas carols were sung by the change were General Motors up 1s e “blessing,” inscribeq in 5°"? at 47'z on 220.400 shares, Sperry raised gold, says: “I pray heaven _ Mrs. Wilbur Cook and Mrs. Alvin Rand up 12 at 284, Northrop Air- to bestow the best of blessings on Davies were in charge of the pro craft up 3% at 30; Benguet Con-| | " over the years. President n D. Roosevelt restored it during his administration but it was missing again after the White House had been renovated during the occupancy of President Harry . Truman common Just couldn't wait to wish you all a Merry Christmas and Happy New Year. i ie te te tee 4S ;this house and all that shall here. &ram. jsolidated Mining up ‘s at 2, and after inherit it. May none but |Westinghouse Electric up 1% at (Ronest and wise men ever rule Marlette Presents 0%. under this roof.” : | ae Christmas Concert Deputy police his address was 184 Rae- U. S. Exchanges to Close 9 MARLETTE — The Christmas : : |concert of the high school band and| locked car, parked on S. Cass st,/bUm St.. plead-d guilty last Fri- Monday for Christmas choir was held here Wednesday. | : , day in Ingham County circuit court) ypyw YORK w — Fi ; After the’ bard had) the (openin last night, Louise Steeber, oo slugging a sheriff's deputy in a RK Ww — Financial and le pening T Areas Represented at Christmas Event 4620 Dixie Highway Phone OR 3-260! 4 4 4 r ‘ é \ | j | Cas : r | ‘ e r i ’ é a ‘ é Walled Lake. reported. Opportunity dudith Smith, 244 Draper Ave., jaithreak attempt Oct. 24. Smith also pleaded guilty to for- commodity exehanges throughout half, the choir sang several Christ-- MARLETTE — Fifty-seyen per-'% ” _ ee the Untted States will be closed mas selections, and the senior choir song representing seven towns at- |" Monday. Dec, 26. in observance of and the Madrigal Club sang eight tended the Christmas party spon-| For men who have not attained a college education. _reported to Pontiac Police that her gery and uttering and publishing, purse containing $31 and a U.S.'the charges for which he was Savings Bond was lost Thursday awaiting trial at the time. early Friday, including the New! near Pontiac High School His four companions in the jail- York coffee, sugar. cocoa and com- Jyvamus Club Elects Two hub caps were stolen from break attempt all had pleaded guil-' modity exchanges. Other New York) . his car Thursday night, Gene Heg- 'Y 8nd were setenced earlier this exchanges will operate a.full ses-- MARLETTE—The Juvamus Club Christmas. selections. Merle Ann Hrwin sang Some commodity markets closed “White Christmas.” sion. |elected officers at its recent meet- sored by Jobs Daughters here. | Queen Mary Wilson was mis- | tress of ceremonies and Mrs. | Marion Hodgkinson led in group S533 wood, 90 S, Tasmania St., told po-|month. The Life Insurance Company ‘of Virginia on-the-job-training will give you the opportun- ‘in the Fisher Body Division park-/aWwait sentence. ing lot. > baby springbok born by & The Toronto and Montreal who pleaded guilty to reckless driv-/ had been killed by hunters, is be-|and reopen Tuesday, Dec. 27. ing yesterday before Sylvan Lake ing reared by Ben Buys on his’ European markets will be c Justice Joseph J. Leavy, was fined farm near Somerset East, South Monday, ity to get a college | $60 and $15 costs. . Africa. ~ Dee. 27, e ; | Charged with breaking ang ¢n- degree. Men who have tering, Billy Burrell, 22, of Van attained this achieve- | Dyke demanded examination yes- 7 ; iterday before Avon Township Jus- ment receive over itice Luther C. Green, Failing to $12,000 per year sal- = == - = Sy furnish bond of $1.500, he was com- ‘mitted to Oakland County Jail pending his appearance Friday. Hit and run accident. Would |\the genileman who witnessed ac- cident at 8:20 a. m. Priday, Dec.) ary. (A | 16th, at Douglas and Pike between wuarance '2-tone green '53 Buick and 4-door OF VR ‘48 gray Pontiac please phone FE 4-7273. —Adv. \ochmowe + Te AED TET if your friend's in jail and needs bail, Ph. FE 5-9424 or MA 6-403). 5 —Adv ee TB 1080 W. Huron FE 2-0219 WE WILL BE OPEN ALL DAY CHRISTMAS SAM’S “Acer DRUGS VP VVVDTIBS C. J. Nephler Co.: £$999999969669 ‘day and Tuesday, Dec. 26 and 27. Dec. 26 and Tuesday, J. C. Pittman, 28, of Detroit, Caesarian operation after its dam exchanges closed at noon yesterday gms | losed ‘lice, He said the car was parked Smith was remanded to jail to! In Canada, the grain market was ing. Cecil Dawson is the new pres-/Ruth Curtis, Marion Hodgkinson ‘open yesterday, but will close Mon.|ident; Richard Sinner vice presi-| and Dea Vincent. Luncheon was) . ' ved served and gifts exchanged in the! a - ‘presence of Santa. : SOK KK Ouse er. f me oo 2 ig % stock! treasurer. dent, and Hubert Horton secretary- mee | bristmas (rvetingsy A + TODD'S Shoe Store To (foun House §2 Christmas and a Happy New Year a RA RE eer om Oy Cc A »- y | a - - = Haman epee ppp » 5 sis Community National Bank Bldg. FE 2-9119 20 W. Huron St. SESGSGSSSSSESSSSSSesesees) SH — A ™ ; ’ . Le A : 5 2] aes : , US ’ ad. (--- : ‘’ , : ae Boe } a ’ i ‘ ¥ A * ie , BE A Ey Ete I THIRTY-TW : O THE PONTIAC PRESS. SA’ passed away Dec | : Po willing to work unity for) JALIFLED VOICE C 2-805 I S or PRIVA:E ~~~ | 4 ph arly settlement. Giv jen Cemetery. burial in Sashabaw | ‘Wanted Real E an 32 A) fondert4) (moftier Somes M In} mum ing age and exper Botti ee] sill be given, students Lesson. Eeoiere ! Refinishing 16A — Licensed, $0 <= mee Beppe Gel Soe te “est |Rent A state we 22 , and |WAN rience . Clos 5 a infinaleuciorg he on» R |, 30 years exp. F' pts Furni gaa [One Bho vy NTED SALES — nse to cit uctoty hom EPAIRIN A 3 exp. FE 5-5201 . . A 2 i sh.d Ld Bd LESM ee - vy Interes e GA éve : > Se teat Neoeten fee ee Bla hee beter God nner APPLY SATURDAY OR PU Bet vaeey men ents miner vues ely. Pe eae, Pe er rotted Knapp Shoes|» w tara Eres -~ R nist 4 onderful F UR on | ~ ot 2 20 eq H urol Ni MLFORD—Service for R eet tales cueibed oh Sato, co iol cog, ee ee DAY On MONDAY WANTED 2 SERENE TIN | Work: Wa __ Laundry Servi Tubtnae tine sre" oR IMMEDIATE CA EEResiss Nicholson. 77. of 515 dd H{.|For er ss Cotanes xen ne in a milion that mot L zaletiog PE STE TS ve inted Male 10 ta ce 18 geen HEARINGEAID 3-1392/ land contract cou FOR YOUR wil telat 1-30 pint s Main St..lconval erlagaslpsia oy oe unmet AT oust a your 3 ther, was afayette cited aes are ph eae) BLOCK | BRICK LAND a Aaa oe PLAIN on eure osha ee FE > RM 10 w = : equity tm your the Rich onday f Hi escent Home 3a] Tight idgment, ainays| in a volu A ee ee |) Mage Sia CEMENT Lb utifully finished M AID FOR SUF empl ardson-Bird rom |Hotel Rooms PI sens gen | Honest ways E : | more ¥ me of busine @ | built. FE va and firepiac aundry mead aha? Pontiac rs Burnes FE SUPPLIES | 333 ipleton, Realt here, w wm. Monday from Rest gisren® 00000200 A | Loved and liberal, ever n ; ceeme e reneete, tae | CARPE SAMS ‘aces FOR FAMI one Ee eee HAY RID OR EUEECIES 23 Orchard: take Ba Uahe Bee a Gee ne Rent Office Space ga) COU We ea tienas Ae gineerng |_Sigsny_ Bonded Insulation Co eo FE ARPENTER WORK. NEWOR RE. 28 UR ee Jae ston WINTE A SPORT EAR: Wanted R eer barca’ lifetime ; rove For Rent Miscellaneous 4) | Our gm sou tase , alll So = gp ee ee work OR he _2-8101 ontiac Laundry. FE mt FURNISHED FE = eal Estate 32A land Cc resident of 42) 0 way nother, that m | | Must b ESSE repal ALTERAT IP RUGS | ——— mi ~ = ounty, Mr ° Beals i niiccen ota : | eee e 1 FE 8-2704 on ann) Mov they io meee CLEAN - ~ yesterday at his sae a REAL ESTA chlarea. ict a ve Victor | 2619 Dinte Hay _tiee_Leundry_ 40 3 name be | CABINET MAKER ‘AND CARPEN- ing. & Trucking 19 Ticotices puuuteryocieeuee: wEw e is survived e. TE FOR S8Al ors . Vern tn i ns A PERMA = Telegraph — | _ 2-3532 Ss @ spec GUY's H ; ner Waite’ , E j OR 3-% NENT, F — lalty, FE AULING 8 s by his wid _ |For IN LOVING XO -O0IbH sition for ULL TIME PO- es & rub SERVICE A St. “John Nicholson and three £5 Sm DarNG, MENRY Gr eUR _ ‘Menwaranergteaengungy | creme Pe edt ne Alaa IN DE rothers, Boyd and three For Bale = e Property 43. Ozbun. who Husband Ralph | _5 i center > Tel-Huron | C tr. FE 44210 "AND haulin, RUSBISH Lic o and Jose and Ezra of Milford Suburban Poca 4a oe Dec 24 (eens ead 4 years BIRMINGH. “4 | é RPENTER AND Wasioe pestle Pumphrey. our sephr J. of Port Huron Td) Por) Bele Lots 7 Sh cere, santas = smn | Cee eon | Murdock FED 2 repair. "ABINET AA-1 mONING TaUC Le SO | (HAS DONE IT : ale Acreage 46 OVING ME children S$ secretaries = kep- | pete 2 1861 up RUCKING, P' | | ‘That's righ ; AGAIN) Harry ‘Por Sale Far {8 dear Inte MORY OF oU ac Birmingha F and waitresse: ELECTRICAL WIR | and delivery. G: ICK- | ' over 66 ght folks. We h y Rou Sale B ™s 7 sell F son and brot R| eC 130 W Ma mplovment Se ? ing WIRING & 1 reasonable ood service at r r cent ave sold HAZE! =? sale masiness Freres bs FP Orbun | wh her Rus- eh eae vice control work HEAT. _time rates. FE 5-357 IS ‘ and are de of our listin ing rein plead eed Ds is pend Prater een: per A sl ee ah me nbemase mitted D A BIRMINGH. —— Gamez FE 2-8657 Licensed Ed REDEO ye G: ef | oa ae er ienpane spend ot rry Rou d- xe : Isrse <1 So A a -e an e ‘Sisson Bi " se. TT. of 126 ange fol Ae and sed his Mom_ broth- CsliQMers OPENIN( 1 FE 2 ERNE ATOANY TIME Local & Lon RD D MOV ANG . uve \ pull Place tol Pan d courteous action, rr , died yest = Both »S MARRIED __ HAU g Distan FE 2- Ease Your Ge are rn home. yesterday male and MAN W AULING A <=! 8787 ur Mind FE 4-2 The body will be . his) FINANCIAL eee Flowers and | sales. plant and oe ee eren ele full WITH 2 C _ FE 5-0675 NYTHING ANYTIME Restore Cr te = 4-2533 Sparks-DeMund at the: ’ a stic. Birmingh: sses No 4+-6471 ork Has INCIN : » Credit \ a Funera Bu pu ~ ' ment Servi cham io MAN WwW ERATORS CL Wh SES! Knees A JOHNSON wel Oak, after 4 on Aoee Gale Land Contracts. np Mae a Huron. t rlowEns 1xtur cauEene Ball Soe PEE Cues crt eens: ef ribelsn \Lsuled TANeoe ash] OAR Le NO™ A 1704S T Oe. Realtor le Ww -_m. Sunday oney to racts 3 fs FE 2 fe e METIC noon from 1 work each after- = - Aes, We CO , sie oe she elegrap . for as a former Pontiac aay. Mortgage pe a F _ Experienced DRUG_ COUNTER ering bundles. of tos pm ane LIGHT AND HEAVY TRUC NITCHING MI ANY Office ae ph Rd. 50 years. resident ans u ___ Funeral Directors 4 part time Se caren re atede | a ales rere wee pases hauled x RUC RING : HGAN CREDIT n 9-8 Survivors sinc aieiniiidaginiags a person. Wesle’ D: ges Apply in c eure is NO) Dems Apply nd gravel PE 2-060 ill dirt COUNSEL nae : ‘i besides hi AIR AMBULANC ~~ U Mile Rd. srmingh mm iow wee: 8 epee Cr enue! 41a So LORS = garet are: Se is wife Mar-- MERCHAND Pursiey Pu NCE GROUND CULTURE fash = Press The Pontiac S4e0oP NG AND MOVIN uy Souen Sacinas 2 1 W , ISF. Z néral Home. ~ RED WOMA —————— c 2-10 and ashes h NG “Above O t Floyd. Eri Seven sons, Dav COATS FU FE 121) pereditwast (niastress UNENCUM- | ORCHESTRA LY s hauled FE akland Theate: ie and J e, Swaps Compiet NERAL HOME Ganlon| 13) side cesldeniWtecicoats tee OPEN Foa * ODEUDIEG : Pontiac, Herman ct Roy a of per Bale Clomns > ss Drayton ate seme OF +718 eC] } bie hours Clive. "out eterences. m0 years tee of oe — deol LCARTAGE Invitation to Bid LISTING Harold a Vv old Goods DIONIF ord Twp | rite bo nces es WEbs' *.1 ana Dista: . of Detroit ak. sieatine Gift ' 0K NIFIED SER wp | ress x 21. Pont PLUM ter 43011 _ Phone es eee nce Movin on Fleet A Birmingha: and Charles of 20" OU oo oe tL VICES CURB a + BING WORK : 56806 & Automobil P 38 ome GIRLS "| —Ressonable._ WANT Ue W an m and two daughters, Por Sale Miscellaneous a9 Ect Fstablshed OMe ee ee eee (Sn PE_5-loie ED ‘ruck Insurance | . Isabel Philli f * Se Y 60 one el Drive-In Pie nm person, Tony’ DIO AND T S O e Call toa . Mrs. Emma Pavlik ot a ontiac and Sele Musica ‘Good a son.- ohns Machine Ton! See Rd _ rae mm TY serv! Gee ee stu-! TRUCKS TRACTO nt This board ts desirous of 648 0 * TROCKE. Realtor of Tampa. Fi Sa! e Equipment a2 FUNERA MI; 35 Ex ATOR I service sh Labi work AND RS ids covertn, s of obtain- UNION L Rea Ls Fla. Sale Store Equi : 6, [DESIGN L HOME Manufaec erience n 8 TO 8M shop FE 2-584 t EQUIPM insur a fleet a AKE RD pm = ED __ E tact ply ot nec ALL | 5 » Ton MENT ance utomob : EM Britain’ - Sele Sporting Goods 64 SPARK FOR FUNERALS Ts Fx purer exbeniccee wobding AP | Rees STRING BAND we eae 1) 1 1 Bt motor venkclng for the seriod >| “TRADES — TP ce s famed and. Grave 6 S-GRIFF xpand RIENC 4 ew Years NTS nd Dum ake = Uary or the per PADE er Banni: miler, Dr. Rog- piaets “tr a Puel | 8 Thowentfu) Service iecRAret Ea ing Its Sgn Ge Cs Ae easonabie rates FE “¢Sas Pontidelarnilan 7 1 18 te yapuery ae We ere specialists | ster, will be Plants T ue ____ FF 2-5aa gineering D rience P Tite stating : Jork “0884 c Farm and mes. farms in tradin 5 a BBC. TV For Sale Per Shrubs a rept ontiac Press Box 64. ork Wanted F Industrial T Deitidie cree tintuen tee, commentator ate oorh EXPERIENCE zs emale 11 ustrial T-actor C A list of th pay seencaaitien (Cares when his Dogs Trained Bo ‘ ees- neat D BAR MAID W * ctor Co, Ae ote motor yen ments are s arge dn med oarded s 10 appearan D le DEsIREs as 8 WOODW pe wibeMt cdl One vehicles to eguity carce Trad duties permit. vel : @ FUNERA a Located Se nebane i, Sa ana te tenon pea tie wore trai iediaer gece Gv comer ce a | aT Ambulance § gAL HOME — | : m ome Bere & ._ ADIY Spud. inGuinaa oo fom ANNO Py eeul ee Kian 0 saa from this for incoubal corenuslean Mone ATE OP M FARM ers ice fens Ro “caer work 84 PER Bue REDUCE ane : Rraved to satisfy e do our utmo bate ICHIGAN—1 MERCHAN CFE 2-837 or Motor qd k EXPERIENCE Marv Dav ~ GOOD CCED RATES Rea'ed bids will be te be all parties st Juvenile Dt for the County of ayes Pro- Ha DISE ls Y GK, AP ERIERCED | CUM ASHER IRONINGS. 85 PF = Large ‘an to s RATES a ices ete GC ER ane ieelieliesied cones lo the — kland,| p. exe & Feed 2 M : Merry-Go-Ro 8 is N) Saxina@ service FE_ ste BU | DAY Moving FE «4 erve rou 8mith anuary 4 1956 Wednesday You pee niment and we wilttgive r e Li 1 c 1 Resta eae = Nest o ve wanna elt? ECs Ea uetoce “1 pox nerups tT ich. pens eres eT sfaman amtieone ne ive, wise sae ive powbi of radi feu _ le ause| sale wat ultry a3 At J 7 x rier taurant Ppl for. Reale's Re i IRONIN VET WIT of charge OR 3.8762 at uy te accep Ge celect at the reputation ac are establi Weigeue child. a Kutehey, father of aig, Sule, Farm erence at ' There 10 am. foday on Automate fs at Union reels Commerce er EM “PreK. UP AND Déitv. "*""* atl? TOMES ARE TRUCK. Oru Somicdie= res my or ef Fontiee « the leading traders Petition having bee ction Bales 76 were replies : arts da sportation A ust 1 DAY E es v of Oakland of the Coun sileging that m filed in thi 76 ¢ the at j. Hand] . y morning, 8 poly Tues: | SERVICE 0 Painti DORRIS the the present whe is Court 7 Press office | < Ing Desir b] FEMALE sm oe ee t bu FE N IRONINGS ng «& Decor OAKLAN . R Ik i S & CS , { the reabouts of | in the sirable E HELP ______| LADY 5-9083 ating 20 ND COUNTY REAL S & SON caknownrnaa said mino followin; | «general WANTED ADY D on BOARD TORS the © child g boxes: 4 office FOR SIRE A AUDITO! OF © ERTS ESR SM ese ne ConGecuniee | ar aairinia| ee Teens ee ee Ben ice ene rsh res Juriadietion men be pinced u nd that! For Sal. rs C ortunities 103 : tiac Press. ie LADY us mates OR 3-1626 ree esti- Pontiac ayette St T1881 Estate Exchange this Cou Laat ihe pier eteteeaeccen , 3, 6, 8, 10 for T LADY FOR HOU DESIRES So LE | 8 NOS NEED the nome of t rt. ent Tratier rs : BUS. ed r lop M DY FOR SoS ee | vear old CARE OF « ee es usinesses ED he | Bpace 78 14, . Bay Aen HOU! a old child 4 OR 1 a . - and com : Mich a oo ees onl aectineroy Auto Accessories 39 16, 17, 19, 22, 25, 28 eee nigcean one stay | '2,,Drexton Pi apse OR a-| DECORATINO — PAINT KNAPP SHOES erties, acreage oF mammorels! prey. ron the alates ou wate hereby notified! ae exe 80 60, 65, 71, 73. 77 ag =e. SALARY _Call after 7 FE 2 089 ace’; caDY 1 Dr ains area 2345; mate wre waass. Call ree . P SHOES ROV RNA ed . at_the J petition will be F r Scooters a1 71, 73. 77, 80, 81 OVERTIM — eee DY WI a E 40255 Test 594 Ellsworth _ AU’ County Service uvenile Court, or Sale Moto: = 88, 89, 97 ’ FRING a ME SHES WORK — = As! PAINT ees 8 Sanford rth = F, Real Cent Oakland For 8 rcycies 2 » 97, 105. NGE BENEF » Lab see TP PE RK BY DAY ING INTER 109 y FE 26'y W Hur tor nex, 1260-B W. er, Court Hou ale Bicycle a { ITs yratory Technic MOT — 2-1037 terior 10 10OR & EX. WEDDING f on FE 32-7421 0. Panttacn inten lone Bivd. in the Cit An. Boats & Acces-oF a4 as ’ chnicians HER WITH TWO SMA | _Guarant percent dicc for 8 ther! ANVITATIONS, A_8-3339 ENSION childr TWO eed Free - cash and Studio rial : of January — County. on the 4 ity of For Sale Anlenen el ? tmmedinte children would lik SMALI| A-l P St FE. e000 | eee oat 18 W. Huron Mat the forenoon. D. 1956, at nine pt day Transportation O se =" technic openings for qual carat lancet hanesctericnill ce ind ris AINTING PAPERING UsED pkins—fast service han Has Bu . . k in Wanted tfered = — tan Meate rable centaered, of othe ze for child ason Thomps RING JUKE BO a! You yers - manded to and you are hereb: a w Used Cars 87 ane R Attractive rably registered 5-297 r work. MA 5- care 4.) pso FE 48366 cents. Or % RECORDS Tl WANT ACTION hearing appear personally Af com: | 5 anted Used Trucks 88 Help Ww ROBBINS increase salary with 2372 esse or FE A CAINTING. P = _ 22 nen Fri. and 8 19 ne demand i anted M As “. s liberal e periodic MIDD Pape AP2RHANG E Pike St at onty force ! s great. Our sal It being im: t saiq For Sale Trucks ale 6 En i : efits. ineludin. mployment ben- LEAGED LAD 4-40 rt removeo Esti ING | you s exceptional W sales service poder gale to make (For Gale Cote 2.2 ceccccccss, 60 BARBER W ‘ngineering Co | holidays. group aid vacations and aeRO EO LADY re ARE 18 rates FE. “Wtd. Child. t Aol IvSting and ma @ need shall be served this summons personal Cote e cee r in ANTED G00: | . life insuran ospltalization and desired, 5 da Baby live in if CusTOM D o Board 26 pal alt utmost certainly b and notic g condition: D a ore G | eral a Apply Po: and i ys. FE 5-8067 it ECORA TING ; { r 19 ye lease one week pre y publication of e _2-1o1t. 501 Good all Roy 10 Hospita} 461 W ntiac Gen- IMEOGRAPH papering steamin ——_wALL|GOOD H Estet ars of ects act you. the Pontiac a talk cake neat copy : Main St, Tenet L177 al Oak _datly. also Geturde uron St retarial 8: ING TYPING _ _merce_ EM 341 a service Com i 7-02 OME AGES + e dealings in ory Real : ; ‘D9 to ervice EM “SEC. Loc 435. 11 Licensed ¢ Fe ‘ures us th Pontiac as- eee cctinted ln acid Geantr ing in Could You U er 474, from 3 to 6 Mam. PRACTIC 3-38 AL PAINT e sures us that you will * Witness, masacceur ® se ‘Some Mond oOp.m. _OR 3 AL NURSE AVA tor with acaxcapacome tee h Wee oe Gs Che pa Moore. the Honorable A @a Extra M nday Thru Frid MIDD ek ILABLE _5-2860 some onen time. FE use old Good: pencing aed cee mliai font of sai tthur E ces ¢ oney ? | rida LEAGE 21 woane _ 0. FE s 27, dav to ist « Call us to- 2 Posciae fe said Co County. this rand aay! ~ | from” 830" to bie how to meke| for Appointment MN Nmemrtaley re Dae er vieeaa way ties Le Li afl ie) PAPERHANGING S recerltuaverse i RADIOS AN your property: Beal 1955 ay!) oon er week miahtall ays a w i ANTED ra tL 23 f CLEA ayers FE 5-8755 D yo U Buy—To Sell- Seal ops ARTHUR MOORE. EE tee Ee Se al! eyed Phone Detroit Protestant nett? | “aes FE ie AND IRON: Pai aurea on 17081 FURNITURE NEEDED | o UatY if’ wrti INSURE IT Judge of Probate FARROW : or appointment ‘on: gewater 1-644) OUNG GIRL inting W: Ww >. |_ Entire h Prove er mnnner yunentey, te OW, DEC 23, ____ |MECHANI \ rasta wack DESIREs RFs. —"" all Washing *% jome or odd lot: romorens RMR | Hele Uaetaleatlen! ole REDIT M “TogiGursee "ig eussbots m "FE, buted ang, ome oot Boe Wont Beat" “Painting Wall Wa i aie = 24. 1955 Ronald beloved w N - - St. 7 biggest and Nn ‘FOR Ti © MOTHER W Corres \ Ing ¢ Ni i i 6 | ale Phone OR ‘om munity ADVERTIS' - a Wr | Farr ite “OL Experten sewin, most exci HE My Me R WILL BABYSIT? | — on all Washing | LE 3.2717. The Board EMENT FOR B nn aughter of M ow, beloved fect ced man for | @ contest e¢ ting adult r home, for w BYSIT ee Estimat FE go T US BUY TI of TDS dea rs Ag! ion activit nside col- quires traine: ver offered or Christm orking = $-2211 it fo! TOR A cians No. 3 Eaucation st acheo!| a! a maar of cnet Cou mos lection pe ceueucea loan col- St ru | Marie uimenses for extra full aoa | Cain aoa os rarest |) Phy sio-Th | ene _for_you._OA 8-268! _ DETION oneal CO, REALTORS ere 2, aaa anna) Ser, eae ios. Fulltime betmanesinadion ctural | LanSenegt te ___ Balding pian Biot ecapy__BUA\ Tanta, Core cua eaing repos bids for tha’ igan, will receiv s City.| Farrow, dear sis atrick Henry hee future Bees mith | peasy of making Sea ust be | _Buildi = vo MASSA FE 4-7881. yers. Cash waitin, Or Gickern| Gren eee phi lebarpota Signi (Bneeeiays) Puseral cree: Seeace aed ae Ste | entertain Or reteen Seeetee i mR Service 2 fecty techuia THERAPY WANTED «| wext Poon TO. mieomticia Ti Grove Element = story fee will held Funeral cery- Wr ce and salary jon. ex: eC vance yee Opportunity” ability ALL Ww = _St FE 42851 chnique. 72 Elm _°% TO BUY ALL DOOR. TO on ‘ownsh! ary School,| 26 eld Monday _Write Pontiac P expected ; to perma y to ad- WINTER : vo urniture Ph TYPES) POST 0} ANCH m. E.8.T. T Pp, Michigan unt , at 2 pm. from ay. Dec. ress Box 92 - all employe be: nent position ON I DISCOUNT Pr y e Phone FE 2-552. FFICE the office dwaedey January. /t6 ee 0 ton Episcopal Ch the Farming - D eta l | handwriting nefits Apply in with) auth eon Spin ICES Televisio Se VANTED FURNI _2-9523._| he office of the Board of 0, 1986 at| Som SB piecone | iCHurs ip with iiey SIGN lers | handwriting giving marital own NUM COMB WIN aN ion Service 22. Ifyou RNITURE CAS Moceteia Tewnshic’ sot Baucation WANTED: REG ——— lurray, FE NSED| ~~~ ound | 4th. EM —— wy oat M’ Schoo! Dis OF EDUCATION na ing aulerment eure yo! DE IP A II. ER A for cofthe REGISTERED NURSE FLOOR 2-0657 ey | WANTED belt School District No.3 F-actionsl Ghuce cemetery er Niemen S | RLY Press Box t16 | “PY Ponier LAYING, BANDING [Por ta SET OF KE ton to — RIDE FROM CLAR! Bloomfield Township and ii se in state at ichouson | Pers A w R116 ntiac eae 0 vears AND| OF THE PONTI Y¥8 IN phon tee Ca tiac. 7:30 in th K- S Hills é | son-Bird é tne ruc C HEC | Personnel O OMAN TO on ern equi experienc DAY AC PRES: _—— 11 MA_ 5-62 e morn Michigan City, Pontiac,| — Funeral Hom uard-| KE RS HURLEY tice old ba STAY WITH Free est pment. euar e | ce MORNING. L 8, MON- YW’ 6261, after 6 L. ¢ BURCH JR. |PH Lport 1 omen MINTS. Body layout tao 6 Filet afichigan |_Siter ry or ssn ee Fie x mates. John ‘Tavior OR|_F INQUIRE See, onc Wid. . Contracts, Mtgs. | 2 Or, ot slats eal machit tes and ge WOME OOR LA FO . S Id oe prety. G., 3 1 bec 22, 1955. BEULAH, utom camee, ecae fitees geal BURNER AND WOMEN & GIRLS _ finishing. aoe SANDING AND UND ‘BOSTON BULL TERR your O SATURD. FPL __ 1068) beloved \. Jonnson ave. uge 61 neon ee tier ebfende LE a at babar for | full and en on SP Bills. FE ¢sai. as beg Cpa fem Fae ASH i it Heres tan't. sold. yet. NOTICE 01 3AL— essmeoehy ee) satay re adarry Interviews d ATE eee Fae Be ee eee ene tee IR SANDING OLD or_ad r claim and pay “For C sn't been listed The ann PF ANNUAL MEETING | 2M r sister of Beular } hupot:,, Sa aily ull 9p.m.. all ., 908 §. Adams, Birm weet ple Fun theaters. Cal agie | _*pecialty Call Bill FLOORS A| LOST: BLACK A ‘ontracts New or Ol Mutual > ena meeting of Th NG 8. nald Bi r Metcallt. = day|PARTS AN in Detroit for | m-| FLOOR LAYING. s. FE 2-8789.| month 2 AND WHITE \ rE 9-04 Large or Smell id. \ uranc e Monitor! Dewe ancroft D SERV interview | fii YING. SA old dog, ‘SIX 4 : | _, suthorized e Company of esbOr | y Pike and » Mis. eta fami Ick MA a nishing. Li NDING, A ner sch Vicinity of W A ° wrt Michigan| Bates: Mrs. C Hier with N L GIVE wo icensed ¢ N ool, Child’ ts- sk for T : 5-9975 | Seare of Michigan is neuen (om erne| _deid Titi wed) Su cs icient = tthe Studebaker | country in GOOD HOME IN THE rk guaranteed contractors. Ail 40274 8 pet. Reward eet ad cCuneaah [ory at 1 o'clock p.m eres January) Rev Voorhecs-Bipl 27, at 10 a.m E ARMACIET EXP. RE Mherses Ante of school, eyes Dewees eee Floor Service red 54 INCH MATTR J.C. HAYDEN tae elt, 128 North Perry at the Hotell Rev. Edwara Sipe Chiper wita | ng. Co I eecoaee se ELIABLE,| time, Could have, saather toh aay FLOOR e uslity Comes First phenyl fetal ad ATTRESS Ce ae ween ot Realtor electing « President « r | une interment Td offi- | 21680 : |_ Pontiac Press Box Detront 5-4801. clean and re _R. Gardner AYING, FiNn.| Lake neal Drees neon hee GET THE MOny FOR VOUR ° term and to ident saa = ae pose of) Cemetery, Mor. in = Morenci | Epes pe Det: \ ress Box rite GENE , 401 Central, FE of _ Reward. I chard| land E MOST FOR in transe irector fun) Mrs. Ph encl, Mi JOrda roit PHARM. RAL B 2-7519 wherea nformation contract, YOUR EALTOR: at/ay lawfully come before the ation] the Woornees sine Fane ee 5 HESTOR penton orosram. BUSINESS Ex. een Bl Brict ‘sone; cement wont fia | Gear Sonevrepnae to FS, Bex) — pie ease wars $eeo Dinte Hey ! -La wee SOON LE DESIGNERS er Deuen tab 6 Weodeuaa’ MEN. Wow wo G work, FE ¢ 1 care ef George C. Wil- 16. 3-1205 Me ee ee ee ona s . DES IGNERS Birmingha & Woodward. . WOMEN YEAR GARANTE ms, ge C. Wil- ' cy reads men 67 h : : portunity on OUND op.| Kinds. ED ROOFS Lost ( ‘T WANTED: - & to any, "anal be Pieced riod | alee adceiedl IMPERTAL DES PART TIME, Peete’ Mase Gn se Oh pur coer: Syria Ait | aeeat Woes’ Bete wane — N Geinad len ee Pat eees © mrinated| vie J. 28 Center. t. Oxtord. _O* vec s ink TTESIGN | BSE: ad oot Jobe, Ton Gare necessary An ply i Saad Mg| Ber Aapiamond fines pivic types of, realestate, “We buy. of his Rogers age 83 belo enter St. Oxt ak 9 Mile 2175: ve-in. 2700 A jobs. Tony's jp -_#erry piy 150 HOU = R 3-37 ring. Re on the ' . ved hu =) Oxte Park. M 750 Wyoming: burn Rd. U REAL EST aE OS MO Lost DUT poe ee Beware t sale of your Land Cor ot feast pos Delos Unde eearafainee) Carnie EXPERIENCED SINGLE _— /PINpore = a == 18. res caleswoman +. or 50a. PL 3 oa) L. SS teen 6 7. ie ge dale AND WHITE ing for we ve ‘mat, we are look- l Ee “4 ‘ : ends Moto quired) ence ~ P : | wit e viein’ E e ry th W at Chae nea Wien Unas Lead tha halts SUCH Ol MAN) _6-00332. r Inn. eT not re-. sanding aed m and city ity of Bald them. for em oF ; ‘ da Will er Carl Dob work by a.m. 10 am. to finishin Laving FE 5-4830, Hanis, fs rs. 8 you : ‘ wood. Pun nh jam Under- _Rd., Roch at 2460 Dut only 12| FE 2-4 ry = be i Reward +s ee. us for the REALTO! hela ira service mptaattcl i ol aici . — : == : Ph |\LOST: - LITTLE BLACE 1, e you are tast serv- 987 Ba R i bald: Monday. Dec. 98, at spe pepe? STEEL BROKERS US Instructions 9 a AND PLASTERING. dor. ‘one BLACK ate) fatgor or te cman Coaperative Ret! Estate E : Home ; g PLLA c fs NTE. : Geutien thee ry clark mera Pat ia. Soar en we Huron SFE BEGINNERS PI LW” | ROOFING nO keke \tequlecainas cg isea ck sed throat) Edw. M. ED: CITY Lots ; werk oe sting. Interment tn riot Pe 20 Blvd. East Pontiae Lines |SALSETROCLE MOST E_ ¢255)/__my_home ANO LESSONS IN | eo “eyPEs | Lake Name: tome howe Senne 71 N. Sagina Stout, Realtor Usherisiemic 2 4 tte im erweed will es salary e HAVE DRIVING “Lessons ROOFING, 8 Son, Name: Niany. Reward. EM foe were Puserat eon a the Framer | ~Tidastrial Electrici = omen Liberal = Driers’ Tr “LESSONS, git AC gration, canter sa oT poze MAN'S BILLFOLD. OR CASH FOR oe LIL AT, 5-8165 ; 4 7 or r sm an FE 24887. es, i : eal _ i. ( A Corp. Oxford. “hdieh "OA 82868." | pair and Tanall prog! ne | “tive lees "aCHOOL CO-OPERA- DeME Bi DG. 3. SER nic lete I, GATE FOR aie Die ner | F : OA 8-2 ies. only 7 eee Mereseres| tek Now RA- V ICE! ees (Norge). TRUCK. of small equiti Saginaw | 1, ne iments in Ev ratemecent Call Michiga’ 5% 10 what we wi ies, If you 7 et| group ron bain Pe na we TGA ee pe ¢ \ _ . hoa. aoe ree ea FE 2-62) _ T: LITTLE BLUE Oe ee — OR ae = Z for your pes hours ‘win oe your | . 5 ; CHA N equit ; pee \ gatne fm"hing. Phon LAYING. Es souvenir off Negara, Falls, rds te what you ic and t { : o FE id as at ‘* hea B. serie ve. 4 | ; — oe ney rE eeu te HARLES, "Realtor Edw. M. Sioa \ ~ \ ; } eosai I ihe +s a TN. Saciney Bt Realtor * - i \ is A ‘ =<— ‘ { r Open Eves. nu ‘ao S168 { * 5) 4 ' * ‘ne t j ' ‘ ; ‘ ) iA i : f : is be é f i g j Pica ? ‘ : THE PONTIAC PRESS, SATU Wes LY. DECEMBER 24, 1955 THIRTY-THREF Rent Apts. Furnished 33, Re ! | le How = : | 3 Rent | Houses Unfurn, de For Sale Houses bed ACE OF ‘HAM ms ___For Sale Heusen aa _For Sale Houses #8 | ____ For Sale Lots 46: Business Opportunities 51 Ms. P 3 ROO 8. deh ee 3 ROOM MODERN i HOUSE PART. | NEW 3 BEDROOM HOME. FULL | 7 2 _Baby welcome _ INC OME PROPERTY is ROOM MODERN: REC Se Etion | LAKEFRONT LOTS | BEER AND WINE TAVERN, FOR | in i in Auburn Heights, 140| basement. Lake ni..ileges. $12. 2 ROOM . -FURN. APT. Gananocgue, or PE 61676. 5505 Clinton River Drive. Pack | pw ieee | oom, good location GI resale ae = 5 = ; ale by owners iver, 3 ROOMS AND BATH AT 21 LIB-| C&D! Lake. E or FE wares Small single i iick possession Low down pay- Just a few left in pew well! Muileona: Partnership disagree- 3 rast iehiky west of Bi Lani se eee r month. fe children §-0242. ROSE McLARTY {_ eel FE 5-2250. ae eet Pr is e | ment, Corner, west o Sky. els. ulre Liberty. i =] | fall ay as they, g » CONTRACTOR Drain Couples or bachelors. 1 baby wel § ROOMS, IN AUBURN HEIGHTS. $700 DOWN ce i weaee jae HOUSE | Von't tast at thie re SUR OES Conreen toe Dene tome. FE 5-2706. Sine month. 3143 York, FE bedroom parer home. Full i — | - CRAWFEF ri 2 61699, Henry. ry. WE town 2 BEDROOM FURN. APT. call after 6 pm. | basement. chimney “@lectrie wir- AUBURN HEIGHTS oe ; : ie ysis evacme er cil ccs tase sides GE. | WE WISH AGE? gk HERE'S YOUR CHANCE TO OWN ee # Rooms, BIBLICAL “CHRISTIANS | tion in idee) eh Ee ‘ 932 W. Huron PE 4.1540 | bl 7 BEDROOMS PVT ENTRANCE, preferred rj stalled. Lot 75 x 236 Near Home. Large Living Room wit! . un Mele [ |) Sewell J estentished (business) end =~ bath. Located off ae ae Yie83 a rE Auburn and Crooks Rd Fireplace. Dining Room, Heated Eves: MY 37085 0 keep your present job. Ideal set- Bivd, FE 5- : alee Me oy Wm. G. Waicomb. Realtor enclosed Front Porch, Oak Satir- | , | up for man and wife. A small : 2442. 325 E. Sheffield)? ROOM UNFURN. HOUSE ON E5-052200 case and floorin Full B | KINS _ | §recery on West side with 6DM. _ofter Spm. Bille |. “Bee owner at 240 8. . Saat ate rs m. eee ment, 2 car Garage. fenced back, | $500 down. plus inv., E-2 terns, 2 ROOM FURNISHED APART- $) so0.Ctit~*# yard. This home newly decorated : | Call FE 5-6157 after 8:00 P.M _ment. 105 Cent iano WaETVIEW $18 WEEK. OP- - Crly LAKE a 2 ROOMS & BATH, BASEMENT) “0D availiable: P.O. Box _535. . 2 apt. Ideal for two. Everything DRAYTON ¢ ROOMS. BATH UTIL- DOWN HILTZ Ch tm LAKEWOOD SUB Money to Loan 53 furnished including laundry rm. tty. Tile floor, 867.50. FE 54-2864 rms las ° ; ae os (State Licensed Lenders) Wee's” mon mont FE 3. oi i school. | sylvia TE POSSESSION, 3 Mountian View opie | Club sub- Real Toe woke Honuren: e See TaLe recente bce = Guiding = : ~ wT block town. comfortable 5| Givision, Mac Lake privi- Olt, FE 96181 Eves, able in tis beautiful ang exciu.. LOANS $20 to $500 2 ROOMS. EVERYTHING —PUR:| room! and rerace PE wines | leees Beautiful view of lake from a ee PO ALL, | “Sine letesids cuedividielteccice | | «Gn (@ienacs a nished for @ couple or two men. mornings or get keys at 23 Porter; ‘/!\ing room picture window. Com- FROM ALL OF Us HERE Ce Pein : De tae era cen Located) On_ Signature Only FE 43130. 139. Raeburn St pletely finished in knotty pine 2 TO ALL OF YOU THERF OUT SE RTE ND Pete Woke seal uen nice HOUSEHOLD 2 ROOM APT. VERY REASON- NEWLY DECORATED 5 ROoM| Qcdteoms each 10.11, Pleasant nN M Ct cies Vappruxieiaels mast ecr oie QPEL a : able rent. Pensioned woman de- _ terrace. 29 Rosshire Ct. FE 2-7943. cree lot. has several large pine cu curs TPPSt Ms : ae Bites oil een ee = FINANCE CORP. OF ae are caae eR T ROOM HOUSE | rated, Tully’ insulated’ “Immediate ' JAMPS AO TAYLOR Joseph F. Reisz vite! fevtrictions “Property shox PONTIAC N CLOSE 10 Keego Harbor FE 17-0904 Possession A ttr | REALTOR INSURANCE : ops 4 Gite ; in. Employed couple only. Must/ SMALL HO! 1TH | _sherin eg See | 100 Oakland Ave PE 42544 NSN i 2 Se Seelnae St wohl Een) _ anes sae drinkers. FE 4-: 4-2337.| niture. 18 ¥ ene # — GEL CASH ‘OUICKLY me oboe Ll : yrone. 1 5 : ’ — 3 Bers Py rarvare “5. Batu, . Ist UNFURNISHED HOUSE -F 02 HOLMES- A BARGAIN BE Ps F_ adults. 221 N. Cas. rent children welcome. Pt ; See this value. neat 2 becroo os u B RTR U $900 7 ROOM FURNISHED: APT COU.| OA 8-2311. em none home! beiul36 [ol good locariin bss WEST HURON (81 A Dp to o preferre o drinkers WALLED ‘LAKE MODERN 2 BE for building Near South Bid = — re Sones 9) ; c 194% to 155 cars. Brin. ur tit Pe’ 22-2680 rooms. Close to city Aoannine and Crooks Rd. §5.000, terms etal Most derls cloweduim Ne ein le: acon rues: APT. WEST SIDE,|_*round Jan. 1. MA 1718 reat eee CITROUN & PRANK ST ae) neowirnce . _Eves. OR 3-096 foans also made on furniture. __pyt. nce. Eves. PE. 5-6850. _F Re t Ro Bren acl Soose | GENERAL REAL Estate ~2% (HE ENOWLEDGE THAT For Sale A ; Sie Dette Ss] a0G Gother eectirties, 2 ROOM FURN. APT. PRIVATE or Rent Rooms 37 4395 Dixie Hwy OR 3-701 r sale Acreage = 47 cence a Mot water and heat fur-) “~~~ Ze) (BEDROOM | HOME NEAR EB. | VGseawuntila= sunday yitol sc wi FRIENDSHIP i8 ONE, OF THE - - 7 cash or Seer = = 4 5 pished. Mo children ‘allowed, (30/2 SLEEPI Tage Sac Pras Bite, cow Owner! i Mark | RICHEST REWARDS OF BUsI- “ing General? Molen One one a and ; 3 ROOM APT. GAS HEAT. _Bivd _ | / = ee road frontage Livingston County 578 Be INCOME PROPER’ NESS WE APPRECIATE THIS No zoning ready for deveiop- + ROSS sueareel Ce ATTRACTIVE, ROOM Gro?| $ froms and aun siete oy = a ment. $55.000 Terms. Modern 8 Loan Co AU- 8. Privilege _ Au ms and bath apts upstairs i CHRISTMAS SEASON WITH bedroom farm house on 8 acres . burn oer zoenize ay pero CLOSE IN. CLEAN SLEEPING An completely furnished with ten- | : $20,000. Liddell, 214 an rib 202 PONTIAC STATE BANK BLDG, en Se ante, “ 7 _rooms. Men only. 46 Mechanic. sou Pig elit cee (ate meet | GENUINE APPRECIATION OF Uae Milford MUtu 4-82,5: F . Ooms, IEAT. $85|DESIRABLE WARM ROOM, NEAR| > spots alte : we oe monthly. Call FE 4-4686. heater, l-car garage, with large | #8 500- A BARG | YOUR GOOD WILL AND CON- —- a - 3 LARGE ROOMS MODERN. PVT cvecnibiny firn FE S711, clock. | jot and garden Brings in $53 per fp Potts | # Wao fed Nie : “ Lower. Utilities, FE 2-5408 FOR MEN WITHIGARAGEUNEAR! lee Total price $16,500 with | Gardens location Bult in | FIDENCE, AND WE WISH FOR UINEEDSIU SUMING FE 41874 3 ROOM peels BATH FUR- eel Hospital. No drinkers. FE | Ave Inquire Se aaa: te! —- . ent ON fonvate ie ree YOU AND YOURS : oe ie aera ee ) eimai 1 ~ 1OANS $25 TO $500 ranc d ao =e . ‘ : ya tite lis loor: fn bd gulet, se May be seen in the morning Ull| SLEEPING ROOMS FOR 3.0R 4 ~ soreness oo _— Fan bala oplctare tw acl eee cluded! Location! vet onlyl | miles 4 Wott be ons Sarees rue nd evening after 7.30. 163) men Auto. heat, $3 per week “ADAMS For Sale Houses 43 , Tor Sale Houses 43 ii ie) pieasaciilivine! rin A Merry Christinas west of Pontiac 64 W Lawrence 2 ROO Danie OaaiG MC. 18 Freet)| PIRSE CEPERING 05 thix isrce a Vote en eee aun aaa amla Vearot : . TEAGUE F INAS ANCE CO. 2. MS. APPLY 29 RUs-: * ar info 53 bedroom home Southeast sec-' A MOD @ ROOM HOME 3 BED BIR \ . condition Better call now ‘ CART W. BIRD, Realtor T oe sac omaae P Meee ROOM. WEST SIDE wen a eity. Ideal oe O com na | rooms full basement Perera state ve ST MIN GTE $1 500 DOWN-—on ti | SST and Happnness £03 Community Nat’! inane Bice 202_N. MAIN = c « or a arg 7 ‘] ncreox * 1 Sn N — a iis Die- 2 . ees a sd ides ‘ c [cope ROOMS, PRIVATE ENTRANCE) (lgse, 2. Gentleman onl, FE) peccment Coal heat eulo water | gas ivar garage Near Bey awn | led baths built in Vaniies pos | ture book home Large pic . Rey ee eee ee ROCHESTER, MICH. es: | ___|SLEEPING ROOM PRIVATE EN- Dive er eet» Bae Hn center. $16 900 with one-third | der room liviary GE kitchen ce ta une besuurgl Ti John K Irwin * AUVERS ‘REAL ESTATE LOANS ttos. * ka aS —— b 1s DWr i verMmacore oven and stove x 4 . = = te J : tihed “couple.” Private’ bath. “OL|— teance,_men_174_peate__ a ed Hienh endjenly) $2000 down G TROCKE. Realtor in color Near Quarton School | * ‘4 room and dining e!! REALTOR ee POLO “ata. __Rooms With With Board 3 38 382 Les Oe a ee 3393 | 1648 UNton PARE Geo CM 4611) 0412 ood tow ny = i ibendl | combunation oa Bienen tiftes ere Cet For Sale Farms 48 HOUSEHOLD GOODS | " ie » Ca 1 1 ot vf ns 2 {room 4 Sagi : on 3 sTREOE ROOMS AND BATH. BY OWNER 5 ROOM HOUSE | 2 BEDROOMS 1 ems, Dattted Avie saePS$ | and tile bath | Beautifuily Pontiac Mich Rs ms P| Ph _ Rochester OL 60711 OL 1-979! __furn., $70 Month EM_3-3474 CLEAN, MODERN HOME. Tw TWIN | tollet and shower. lot 70 x 100,{ Full bath, oi! furnace. laundry| ‘Teplaces 2 car garage |FOR LEASE: MANUFACTURING | — font offices eer conrem * P by * ir fo 4 \- =! a) tI a oe . r y +T =e | +. « j ie W. Columbia, | fice Tex consultant insurance | ______ Fves OR 3-0096 _ ridge is Cee ced” to see” Call Modern home loceted on main | \\ ARD I 5 PARTRID¢ 1E FO . VIDEAL HOM E Plant. Brick and concrete con- where you ape ee agent or what vou need 3111 s ARMING TON now and iist with Partridge and gravel road near Oxford House REA] TOR EE 2-8316 coe Xprr range enn struction. 18.000 sq. feet with cf- tow up tr $500 on small J ROOMS AND BATH HEAT FUR Orcharg Lake Rd FE 61131 join in our great sell-abration provides living room. kitchen | 9y yay, ; 2 Paeatiies on cere street. Near fices. Gas fired hot water heat once - a - month payments. Mineo Pe ECADILUAG ae _Keego Harbor Michigan 3) pedrecm home eluralsned eee bedroom end beth down Large uron St Open Eve 7 to 9 al Slanhea ; See eee roe | valeecinn ten nak SSeanveraill Hire get full amount, no [D. % 5 * * unfu * & ’ s é 1 + Dr =| = t , rac t * t ry ¥ rtions. 54418. . For Sale Houses _ 43 heat. city water and sewer \\ \RD 1 PNR ! RIDGI bednoom: ult honcuenl New _ a b home with center hall affords 2 unloading docks and emplove etue é — >: pices to sell $3500 down to J}. \] [CdR FE 28316 ou furnace 5 acres good farm ete, ee pe ree! parting bo Located at : r 1 nortga “ % ' of Pp ull base- t i 3 moons eh! BATH. NO DRINK Rag ips aoen corner ae ‘\. e PRI MM. ke iltor So eB Uroni ee Oven gE ses) a1 8 i: MEAGHE R REAL ESTATE Helter oder tusb. etc 2 por eS Corporation, MI 6-11( ie) os Deer Bt beckeors peed s 1 child weicome 3603 He’ Upper rented $80 pe: . Oxford Mi h OA 8-3122 Ry fenced (landscaped lou stir: |= —— THAN YOU TH field Rd. Drayton Plains Ob side) jocatlon 5 bloc ks {rom Pus 30601 Grand River GReenleaf 4774 - bers some fcult % car Karage Business Gpnsciunitice 5} ? INK : S ~ — ; 7 ; Cement drive Ofte at £9 200 . epee HeNTED RPT : $i seat a ONLY $380 DOWN VACANT BES] $2500 cowr WORTH ite MON.: SOM Feneserec le REAL ESTATE. €Mp OQ on per eee een WSs OFFERS EY SEE IT TODA “LETS TALK a covece eas Pd ane 432 W Muran Pl FF 42504 haces Beads Ue “ : " 3 age 4 ROOMS & BATH ELFCT HOT L 4.1906 - To buy To sell- To Trad SINS loan company eee on ornere ie me oc wane athe! DOWN Wath Sincere for the St ene ior el tt as + aie = BUSINES: rance, Working couple preferred | D&@) t 710 ; & Se = : Hf - S| ONE WAY _ Best Wishes | CHAPIN ee ee SLeie DOS uckner _ | | trom 6 room and bath brick ter- . So.500 DOWN ROOM§ AND BATH ON PINE COAST TO COAST. . m QF So. OW: © gnobe | a. OR 3-8033 RENT HERE LEAVE THERE | fora BROKER-BUILDER ce R. i ' iecen lan ecod condition fuil Sure) sand | icontracts) cr ehomel a eemertears j < : 3 s t with gas heat. in W ROOM FLAT HEATED 415 PER) p woe land, oes il | Fast Columbia St Pontue. sat. TECOTOC rwin kood Tesidential area ciose, (ey tekeicerelief (be seen (87) Finance Co week. ane children. 3000 8 at : ‘a | er home or will complete, 2 bec | to buses and stores Price REALTY CO EALTORS ment You can be your own boos ‘ . OR 314 | erry | REALTOR 268 Baldwin Ave aad and write yourself a nice pay : _ _ Bell FE = rooms. Lot on 50x180. city water | rE 59101 ono ans FE 2-6544 | reduced to $6 500 FE 20263 Clieck the! ftreliweek A real moe: a} ae TERRACE, CLOSE IN. ‘FOR SRERUNONAM. PROPERTY . Sic *OR 3 Sa street. FE | Co-operative Real Estate Exchange. . 1078 W. Huron | ey maker and a place to be proud | Offices are located: Secdteemeiac aGane, S10 Write x MIFRRY NIERRY Christmas Dr. AY TC IN WOOD: _ : Commercial Frontage NEXT DOOR TO BRANCH . A couple! can ocafyne and fn | Pontiac, 2nd Floor, Nationa) Bidg. Adal ALE . RK = icell ecg POST OFFICE oy working here Full price $1 , : _Bor No 83. Pontiac Press _ Be / Excellent business site on ee el Orr re ee $00 Good ac — ; = : 5 Oak rith § - modern building & Prop- « Rooms IN-LaKE onion IN) CHRISTMAS TO ALT. and | for the “discriminating buver ve — fice shut is wit Fan For Sale Lake Property 44:0 erty priced way under the mar.) DU7¥" Pleine 4612 Dinte Hay, qure EL N. Hemmingway.| (y}° YQ)U—FROM ALJ. Ha | home bas everything Living room basement. gas heat extra ket also available Walled Lake. 230 Sernston + ROOMS SDB ATHEPH =) aye 1S RD. R Lik} eee | teal beautsiu! fireplace Kitchen is sex eters 2 car ggrage $15.- BY OWNER! GOOD FOR RETIRE- MICHIGAN BUSINI - | iBext to Bank) : 1 : XN s INUIELE DY, pianned for efficiency Attrac- < ment or «ports. 75 acres near J DAC) PRO) 5.7494 | tive dining room 3 huge bec Imlay City 23 cleared balan = . ica ARCADIA APTS. | Bt ROKER. New Y i Car rooms. Ample closets A Bhiding Sea son's Wate moun ® ooded terrain | Borders useee SALTS COREOR ATION ae ss woitta, Van Dre pane | | es . doors wil «basement tached ar — , 7 lakes = @o ishing almost ', 1573 Telegraph Rd | 3 rooms ond = 9 children 1 im af hes ated garac And a beautiful . 6 large tnt! oR. Sie) mile road frontage Only $100 FE +1542 Ge HEMPSTEAD W H I | on | I engl 2 | Greetings ——1Rnatind “Geasoomn with Brokers tied Over ‘ap0 Fors Pieoty of Parking at 1 GE ORGE BL AIR THE LM A M Re “1 WOOD we oe plenty Tot Pexira!) room) {or |) Rochester.) Michse Olive 205510" | PRIVATE. PARTY 102 E Huron FE 4-8284 ais We wish to extend to our bedroom and bath on sec- \ WISHES TO IN- BLOOMIELD TERRACE. 5 ROOM HELEN Mel NU i sALL rE ate woe pete i many silico and associates ond Full basement gas Vatkins Lake ¥F ront ! ah gles orca i, ek in | prove ae Latnaenoler 1008 6 coeath JIM QUINI AN ¥ - < tes ristmas time eur - steam heat Situated on lot Beautiful 4 bedroom home ab Feae Box & = fac to $508 Stove & refrigerator. $85 a month BROS. . A NLA. heartfelt thanks and appre- 609x250 close to schools, | ing 90 foot frontage on | _& a CoMMtGnITS Okan ro Call at Apt. 103, PE 65-3321 kK 1.7 empleton Realtor 0 ‘le ciation for a happy and suc- churches, and streets. 16,- |. sandy beach. Living room 142). | Lawrence E 27131 sch pt th ee 1. . tessful year. 500, terms fireplace, dining room, carpet FRIENDLY 5 CLEAN 3 ROOM APT. TILED ES 2339 Orchard Lake Rd. FE 44563 ( V il ans tile bath. ERVICE bath. 8667 Pontiec Lk. Rd. NEW HOM + | ____After_6._call_OR_ 31706 ] ] To the many friends we 5.000 D good view ake Larne wer | lComplete auto sales snd servi WHEN YOU NEED MODERN YEAR ROUND NORTR 5 ; have made and the. friends $3, o“n SS Toom with shower and lavatory.| gas station, Stock and equipment. shore Union Lake front. private THE “ELDORADO” = : = AS LOW AS we hope to make. We wish | Dravton Woods Oil heat, 2 car sttached za— odern building, 60: 40. y42.00 3 rooms and bath. Couple only, $40 ang FOR COLORED a very Merry Christmas 2 - rage. Aluminum storms and| takes all Terms mow O per Mo. EM 93-8704. Gl's $750 Down PAAUILIES — 550 D and = Haces and Prosper- | el aoe Cale _ Sc eet sil ticele landccecca s all. 8. SSS = = «de + es ous ‘ew ear. ec ome, i iS ~ — - NEW 3 BEDROOM RANCH HOME FIA $2,100 Down 276 Hughes street Large 7 Own?) emt with off AC heat, & lee are, ee Sen TRAILER PARK Nou can get it guickir on four s S rooms and bath. all in good Veins ra attache car garage Vex- | La car or furniture. N: ranch home. All draperies tmcluc- Full Price $14,700 Ce ae ee te etree PLUS COSTS Ray O'Nedl libuie entrance. IVI FOOM Teer Lak ie spelen 7 wea _| dorsers. Payments to suit your eo, Oll furn., 2 car gar $8500 Mo iy CLARKSTON GARDENS WITH | income. 2 lots. fenced with . Ril ONeal : 13424 2 fireplaces 2? bathe. Leer Lake—Clarkston ie mere ces later n laundry | budget We will. be glad to heip est side Lower § ba’ H COMMUNITY WATER SYSTEM nice shade Pric> only $8- PAYMENTS $3352 PER MONTH : kitchen with adequate cab: Situated on well landscaped 150 t One CY y lack | you with vour money problems. furn., $8500 Mo Nicholie & Hara) oo. tie first group of brick 000 Also several newer 3 PLUS TAXES AND INSURANCE Melvin Skelton eilenalinat: Gane fa tecielakelront el tTu® becaihil op roads of Michigans e e..3 uron. ES | “i t Tete ia Clerk | ie at =. oiel eper daily and sundaes fh i : I xtIt wits as Fa ah Rio agg aan Kile Co, 37_W H FE 5-818) ‘ = Move] , x1 - Lt finest $30.000 will han = a ranch bomes tn he ult in Clar bedroom homes [ Ee Pease 7 Bus i tre Irimeat J of 4 bedroom. 2'> bath brick STATE ST 2 ,fooMs BATH ston The following features arr treor Bld price Com $8 - Bot oe bine Sop € a New Herbert Selaet ate pO--exsion 8m cul-tand home one of the finest in toe VILLE ROL TES stove utilities $% Wiliams St + whar im nin’ ned yO uy cml Mr iow ar cms ben we et ms n ! F ig value a: $2" 950 res Paneled living r 8 : NOW . rooms. bath utilities, $60 Wa'do That home. of your own at s all 2-641 OaXianc Tey DEC EOOAy . SES Dorothy Bette . " 10 wit oe firentace oy ? if IN VN CE CO Satin eee ne gtk 1 ee ate eames Se eel room tevey mee om au! Nelhe Rartonbake: Laur ge Hons i, Soaron 26xd con! Ceramic airs ar ang ive cream buse-+ 97 pooiiec ‘tain Back Bi , ren FE 53-8183 goacloux living room has a beau in mater, Ineally en tiie beth sliding windows MarveMaclhadven {oomnmercial Frontave x 32 screened noreh with built- ey ea ait canion aoe Fie © Gis nk Bicg WEST SIDE APT AVAIL 2 BED- tiful window wall For extras (j7() \\ [lure St wood floors near school shopping : - Rituat = in eriul and oven Automatir ofl wil] handle rooms & bath up. Living rm, din-| conven.ence there are 1", ceramic | ; __-. sand transportation. For esansoal) Marjorte Randali hacde oo teen ees heat. attached 2", car garage CUMING Real oo ee ing rm. & kitchen. Separate base-| tile baths with colored fixtures information. cail . cae . ; nibelt eet of frontage $43,000 terms oN wa NE MOM, Realtor ment. Gas heat & utilities not| The home is heated with perimet | 4 HOME: OF YOUR C ll ] Charhe Rawlms cod iow fect decp cn 2 ane 30691 Grand River GReenleal ¢9774 ___ Mortgage _Loans 54 ner reson ee a oan Amawen, perne and OW N | aste eG ty John Moss in eases condition pres- Ro Annett ] Cc — 0 ame e 5 In thy at 9 oval 00 R sh screens. Large lot, 100x150 for 1601 F li MILE RD Elwood West rental “Oeeers acaneen Y ne, TRADE a ANS $6 to $1. 500 , ent Houses Furni: ed 35) the children to play on Winding | NEAR SILVER LAKE Nice 2 bed- | JOrdan 6-0708 __ Lincoln 1-1788 | . ’ has € rooms. fireplace. i's | REALTORS 1. For any purpose. on eee ~—~~~ | blacktop road. Close to schools rom) Deneee fee wat errr —“T AKEVIEW HILLS | Robert Smutz baths. Other 2 Bedroom _28 E Huron FEderal 8-0466 homes modem or not tn Stee a and shopping, US. 10 to MIS to) Fu UNO Tiuiation storms, |. 3 bedroom contemporary ranch! = \fonroe St. Amant apartment rented for $60 a Open Evenings and sunday NORTHERN LIQUOR 3 For homes 930_LaBaile er Claskaton cea Hane, 3, mile] screens garace. shrubbery, pava homer: ‘ake privileges = per B; st. Ama month Divided <1 any “IN. AQULOK | imtcciomene additions or § ROOM. PONTIA: E. $15 P ‘d menth. 15 minute to ‘ontiac | - ok with 2 oi steam furnaces > . incelienarag a AC LAKE, 6 MB) te model: Open 1 to 6 daily) | “* 4 food value at ht.oee: serms) ee een Kahner Con- silly Buck 2 car garage Ideal for iarce | > ‘Sale ‘Suburban Prop. 45A. Eight month ‘ovor bar tp small an ee eee S$ ROOM ODERN. GARAGE | SENECA ST Rooming house 9 _ ‘ruc | : : ; : ico ossibilt town on the main Highway . Sai ry Scie ts Auburn tow sy rier |) rms, with full bath up and lave. WE WILL BUILD ON oor tor, RAY ONEIL. Realtor tes $28,000, term< | 1 the Straits. Small arocery in ‘ israze homes or on Hgts Adults only. Refererices. FE! Jl ST 4 HOMES LEFT tory down Nicely arranged for 2, 40x22. 3 bedroor: shell house 73 W Huron Open 99 . courec tion (Owner siauarte te pius $ On second mo: 2-3843. FHA—CIVILIANS families. Large shady lot. A bar-| Cost you $4245 $110 down, $45 Phone FE 3-7103 or FE 8-0789 Prankhn Boulevard Totecurdilentstat Ifots additional income included. Only Aes Pitter 5 ROOMS. MODERN. $20 WEEK. ie Sais gain at $10.500 with terms To mo See our model. For addi- Co-operative Real Estate Exchange excentonsily fine brick Some wooded. Some teal Maectirate for contearts Me pron: Pontiac or nhone FE 44720 _ ty Walled Lake. MA 42777 £650 DOW N close estate. . tional information contact : nomey fea aluring mai ex for tri-ievel| Some lake erty a Swa 35 8 ROOM BASEMENT “HOUSE, GA.| VERY LOW DOWN PAYMENT NICE WEST SUBURBAN Neari: R d H i MID\WESI Neen acane Sooan eee oY LeHTeCEY A) SEN \ , ee tots ee, rage and breezeway. 4 miles out! FREE sroeus AND ner w ms. bath, utility Plas- eC O Se) : : re ki ; . CIA it cones sedi Wreenesey miler eel) ces STORMS ANDO EE | nes) tsom beinvueality Bis: EMPLONMENI room breskfa.t room large \RD | PART i Mo: AE MOST NEW JAMES DISHW ASH- ,-ottiee in rear, CHRISTMAS! large lot Reasohabie with $1,000 sie Cass Rie Ra | Wishes To Thank The Peonie of baths. finixned 3rd floor oF ROGER B. HENRY. Ine. helh ALTOR HI 283160 Chuai value of will sel OR See Sn conas DUPLEX ON SEMINOLE $51 PER MO. INC! TAXES AND, dn. Move right tn FE ¢7752 or FE_2-0179 | Pontiac for Their Enthusiastic Re- heat. lot 66x275 9 car ga- S11 Main St Rochester 3 W Huron 8 Open Eves 7 to® gry = ———— er A ear ar Se r List YOUR HoME witH vs | [immediate P. "| Fin Year ond so tues ne we rage Price of $20000 in. , __OL_ 1-0111 or OL _1-8121 “REALESTATE E BUSINESSES OIE nae ro a aaa i 1S ee ludes carpet, drapes and —— THROUGHOUT MICHIGAN non ws soni TORENT EXPAND. aloe a “room an ante cal mimediate Ossession have Made ere - lode’ bebo tof cuue F Ss ale L cars. H. J. Van Weit, a 3-135; h be h " uture Brighter refrigerator or Sale Lots 46 = ee. it, O bg _ ible trailer. FE 40078 ===_| fioors and Youngstown kitchen | NICHOIMIE quouar Osta, wie onivilece pa | For the Many of You that have - “10 BUY, To SELL, REALTOR ° ROOMS. 4 DOWN UP, 1's FURN. WINTERIZED COTTAGES| Folding stairs to storage in attic. oes fine sandy beach on Union Lake | COM@ to us seeking our assist- } = -_ i | PART a baths, lot 100x300 ft. he fin- Exel is RTRIDGE Is THE “BIRD” TO and trailers. Children welcome.| Full price $7,300 Model located & HARGER : ance in finding a mew career | xclusive Liomesites t ished y' 3810 Dixie Hwy. on eet Rd.. just north of 33 W Huron FE 5-8183 ends be oven Comer: Walled, ——-—_-_— = eee ee Oy nne Pier a. ecauiiful’ Fores lak SEE ore Will take, housetrailer for — se $$ $$ ake school system as nice autify ores ake Cow rom city limits, MODERN HOUSE, UNTIL JUNE Pelton Open weekdars 3 to 7 : . sized living room. Seaprate aes, | A VERY MERR Y REALTORS try Club Estates and Forest Lene | _full_price $7850 FE 35-7660 18, °56. Children welcome. 10 Mi Wi HITE BROS. LAKE FRONT HOME, | ine area. Btep-saving kitchen Au- | ; aS ALLEL ASL 28 FE Huron FFdera] 8.0466 Orchard. Also our new Shanes | TURN IN YOUR OLD SKATES west of Pontiac, off Commerce REALTORS A iat zs . ess tomatic washer & electric stove | CHRISTMAS | Open Evenings and Sunday 1-4 Hickory Knolls in beautiful on & new pair of sieds or skis. ee eee 34008. Phone OR 3-1205 and the ultimele in styling ee eee ata a |) tO OME AND ALL FROM | Bee cence at teen Tercrem QT r 1 ge heer ee Coe =: = 3 ca enced shady : a new office at 8. Telegrapt bi 7 Meath end utility, Sét meat COME: | Open_Rves. Til @ — Sea 1 to 6) ang equipment. Has center this for onie $11,000. $2,000 down. | | Rd. Open daily @ am toe pm | | campiete line “ef fireplace “fit: NICELY FURNISHED 4 BEDROOM In BUILD NOW living room with floor length EM BIE E& GREGG | Wali oh: , eee tee Me oe Wises oer |B B \RNES HARDWARE house, Modern. 1349 Bast Lake our well restricted, Waterford icture window wall and 1565 Union Lake Rd. ore . . “+ ~ a > Drive, piebeo Lake. DUnkirk even, (fom our ‘plans or freely oman brees fireplace, din- ; Teton Lake Vilage NED 7 | JOHNSON, Realtor TODAY'S SPECIALS 14 _W. Huron & REALNICE ~ | HERBE RT C. DAV SHA Thoripader tease Gav | EM 2300¢__stt_ EM 27766 hi 1b O4S. Te elegraph Rd. | peruxe TAVERN on main high: | ioe) pilek c poe DeLuxe tk * of = : 5 P |i - I and electric dishwasher, 3 REALTORS or | Se Dict ‘ 253 3 war northeast of Pontiac. Excel- 4 as : 2 bedroom home. Completely fur ____ 4925 Pontiac Lake a S bedrooms and 1'» vanity tile , 3007 W Huron FE 43059 $6.00 Fall Price se I E i my : lent fixtures” inciuding” custom | wit iredesranie ere >see mished. Pontiac Lake. Call F* oo dl baths. Hi-Fi music system | OPEN “EVENINGS ‘TIL 8 \ See this 2 bedroom home LAND SUITABLE FOR SUBDIVI- bullt bar Home available ly | et lab Only for good land contract. Call Mr 4-0619. iN EARL. N R throughout. Attached 2 car oi located on a paved street sion. Lots for immediate building , $16.500 on terms. \ Hall _ FE 41551. M VIN - garage. No doubt your pres- | #:. 8]8 ; just 2 blocks off Baldwin | sites. for multiple commercial | See SMALL FURN, HOUSE. 1428 2b $4100 -D t and wood off Josiyn, Phone FE ae endl ent equity is sufficient for 1Vi 1anS OWN Avenue Owner's health | Industrial use | ONLY DAIRY BAR AND MILK (2 ‘GOODYEAR SNOW TIRES, 710 5 +s ea new home $11,300" with ou to buy ‘The Home You : | Modern 2 bedroom h forces sale on this property | depot in th b | @inch power saw, Will ex- p.m. wn. Monthiy payments ave vAlsaye) BeenuLookt m home. Complete Canan { | DOU ny ise topnotc i: © loca Hon change for outboard motor. § or ineludin ta : ¥ . ays Been ng storms “and screens. A nice cor- an be bought for cash or yY Van in the middle of a busy shop- | Rent Houses Unfurn. 36 36 ly $63 nee insurance re fine a few other new ner lot. terms. — - i ping center. Business growing ev- |... "-P-_ MA | 3023, a WILLIS M. BREWER | f= "ome selec C.PANGUS 1919 M-I5| Near Aut | Real Fe Gots ot) Des ss ba rt stored SIT TE, oo > noueme Son, FET oMtys| WILLIS M. BR yon OWT) | 5 Pe croestte cates >|. Near Auburn Heights eclty | Stasuarenths aioe yan] “Es, eovtattadl™ “eS White Lake Rd. PR ise; FE 28532 EM 3.4000 WATERFORD AREA Pana Ceaat i fend Canes priztience, is clean as a pin. Located ~ 2383 aT WbbLE BELT On|, neues (onl) ootese, Sr eiayie. (ol PLYMOUTH « DR. BFL 45078: o-owne: - e eqes fone - = ‘Adul Ot. -— BEDROOMS. NICH LIVING Mikes eco may win comfort, Q PLUS COSTS 100 x 129 ft let. Immediate pos: trust irscameeds bertiect a FE 5-418 SUPER GAS STATION located| miles, Excellent condition tien tos ‘4 Rook sore SRT FoR foom, roomy ay and tile; | This wBanaafe all-white, sien $1200 down. EM) ~ good spot for the city (es ewer o Sere aes for housetrailer. Call Cy Stes) Eee Bereta tc ) eS DRAYTON | Bees = wd nished. 792 Young 8t. {] Beth. Ol heat. carpeted and lan ‘Tem oed ton ae _. PAYMENTS 636.97 PLUS VACANT 5 fot farm ee ils. per mo. Included lake front- | —— a nn A drapes, t transferred, Call ee full - «.. @Oo lOUSE. ong at $1,500 down, so __Fe hin between io am. ond 1 pm, PE a: Delco oat heat Price ewes column amc __good iocaiion, bargain. FE 2-184] see it now. i oe eas) additional income. nee or or Sale ¢ Clothi ing 96 36 tw : carpeting. 2 BEDROOMS WITH POSSIBLE WOODS > * Mode n dal 1 Robin- < = RENT IT FAST : i soe! Mocks south ot Perry, | {itd Bedroom up. -s6000 with s6bo $1,000 Down WARD FE. PARTRID BLACK FRO, MATERNTE LAKEFRONT | contd of Encl EBIvd i Gee Mtest || ee Lecated west of the city | fA, lmited number of excellent 2 Re IDG iE aa ° ° through Rent Ads! Room:| 2 nedroom home with full base- Ghrnaiae a A 5 Bedroom Beauty — ice ti beareca some: wee MecULiN subdinisee, Presets | REALTOR F E 2.8316) . ment. Completely insulated. In- é _ WITH LAKE PRIVILEGES tesea wallsn & nee restrictions, FHA. a ed | 2.W. Huron St. Open Eve? to 8) tas mcoee Pee besa Lovely 1% story tench t red walls. hardwood floors, Pproved | REAL ESTATE & BUSINESSES “XCE NIT house, apartment, any-| ots overlooking: the lake. "A reel with dining room, Treated rece. | (TL aesement. cual BA heat ranged. to eee eee “S‘nmouawour wicuican | | EXCELLENT oi gm or | Cast l] R It vay. 2 baths, fireplace im living large 175 foot lot Call. | | CHRISTMAS GIFTS thing — Want Ads give 8 show you today. e Caily room and basement 2 car at- for further information and | . | NEW SINCLAIR | SERVICE STA. | " CRAWFORD ceptional valve Salt oneal _Pigne tat Seal” Walled Take} LIORT BLUE ACETATE P 1601 FE. 11 Mile Rd. “Royal. Oak | Pine View Dri Middiebelt |. we BA Dies. y ACTION. Dial FE wk; re «ise Whee lbne bance tt | gn te ee gee 3 CAN SELL YOUR HOME. | HORTCUT T role Dies sorts s. siZes * zt eee ier bile i, 7 ge ene aeaiee ec le w. jules Giles Really Co. sai | _ ON Dine Rey, CASH: Classifed Ads!) Extensions trom tos. aioe : ‘ aa MI 6-2900 : ; “Open Sto ® rvel cae 30008 FE 28181. i : : : ; i : . £ oe) Aas | 2. : \ oar : — . yy \ : i ft ee vi ea Me . = 3 i) oy \! : i * * sy Hone { m4 4 ; } be 0) \ : | : ‘ one J ae a Ne ee a) tee xo Se ot THIRTY-FOUR ~ or a rm ee ae rnp eee . | ! | ITS A REAL PLEASURE AT | | THIS HOLIDAY TIME, TO SAY | | "THANK ~ ' Wishing You | YOU" Holiday Wish | 1 iis Is Our | AS WE WISH YOU A VERY 4 | “ z a 1 yto "TOT AY joan Vow’ ; MERRY CHRISTMAS : AND A . +] ' | N opoX” WoVEAR A house full ot friends | HAPPY NI LI of prosperity & @se and ali vu. eI ll aecl Mos} desire he ull o heer: . rear tui ‘ Ron ‘Doc: Mountain Merle Worthingtor Votn & Bally Horivite sharing i And the joy ot —_ MICHIGAN.-FLUORESCE WF fi + : 393 ORCHARD LAKE AVE MI through the vear. MERRY _ | Christmas |... AND |. 11 BROWS AND ASSOCIAT! WE THANK YOU YOUR PAST PATRONAGE TAKE THIS TIME Kkealtors 10 WISH ALL You UF AV) Happy Greetings | Merry | Christmas New aA oP AND this time of expressing) | our appreciation to our! Year! | | Prosperous ness associates for their trom | and join with all to make’ | We enjoy the privilege, at chents, friends and busi- New Year | patronage and friendship’ this the happiest holiday| Everyone season with prosperity in OAKLAND | LOAN CO. 202 PONTIAC STATE PANN ROG: SAGINAW and LAWRENCI Hargreaves PHONE 1) 2036, the coming year. ° at | Forres Matthews- wh ene, To Buy—To Seii—lo Insure MAHAN | REALTY CO., REALTORS 1078 W. Huron Phone PE 2-0263 Open Evenings and Sundays | Co-op. Real Estate Exchange COR | GREETINGS | CHRIST- | MAY DV OUR MAS BE A HAPPY] ONE AND THE NEW YEAR BRING THE, | BEST OF EVERY-| 7 | THING 34 Mill st | | Jackson's Rental F quip | 62 W. Montcalm FE 4-5240 Chevrolet | [SEASON'S GREETINGS To All Our 211s Saginaw xt. Friends & Custeme:s It is our sincerest wish! that we may serve you, during 1956. ; MERRY DORRIS & SON REALTORS SINCERE WISHES! TOVALE Happy Holiday Season OUR . This changing world f.1- BAKEE eg ; Fo CLEANERS & DYERS | CUSTOMERS } brought much the LEONARD EAKLE . au eed 131 Oakland Ave, FE $-893), , Hew and ¢ ~ —— 1! JIM WRIGHT, Realtor | "445 Oakland Ave Fe 5-941) But nothiee tier than the Co-operative Real Estate Exchange | - ay WE THANK You spirit ob © hristmas FOR YOUR PAST PATRONAGE \_ AND TAKE THIS TIME | TO WISH ALL OF YOU A VERY . MHt is in this sprit that we } . wish vou | The JOVS ot the COMTI 2 MERRY Merry CHRISTMAS ; | Christmas Stason, FRoM | L. C. LADD vl ng a {4286 Dixie Hl, mo Plains 24 ! ‘erry HAPPY | Phone FE 5-0201 or OR 23-1231 | | Open Sunday 1 to 6 PM NEW YEAR We wish You and Yours a | : | joyous holiday season. | | CORDIAL. GREETINGS NOSE VGLENNERS and LAUNDERERS And while at it. We want | to think You sincerely | HOME 6 AUTO ' LOAN CO. | for your faith and con-| | fidence in our business LESLIE FLEISHER MANAGER BERKELEY VOss PRESIDENT 407 Community Bk. Bldg Phone FE 5-8121 MARY HERALD 339 S. Saginaw FE 47101 MERRY | CHRISTMAS To All Our Friends and Chents We Extend methods. To serve you! well is our aim. WHITE BROS. PEALTORS MERRY CHRISTMAS Sincerest Greetings } | 3 peas | - AND jor a Happy, Wholesome || HAPPY NEW YEAR! | Holiday Season Phone OR 3-1295 SLACKETT’S Johnson Radio & TV * Ceenip to)*, Semdar t/t) | , Building Supplies @ B, Walton Bia FE 47001 : : ' 8161 Dixie hth Clarkston &-5811 SII IITITIIFTITITITITIIIIISAT IIHF SHARIN (MELE RICE CHRISTMAS — | HOLIDAY GREETINGS MERRY GREETINGS! | CHRISTMAS BEENON'S Season's Greetings he | May good health andj U Soa Nits | Spree al pleasure | | a ; | llappiness be yours all lo he able to extend through 1436. \ll Geasot’s “FOR A the decjaelt fareetine | BRIGHTER ~ Pre Bool HOLIDAY | . Lunch S03 & SAGINAW FE 2-23 r Merry TOP IDAAWGREE DINGS]! TO OUR Customers and Friends Christmas < OF _ ROCHESTER “ORESTPAM CLEANERS | 97 Oak.and Ave FORD | _ DEALER Wao SON WE SELL THE EARTH’ ce Sey | 5 Oak St 4/8 W Fourth, OL 60371 Roche-ter | —— YOU WHOSE PATRONAGE | WE CHERISH To Our Many > CUSTOMERS, | PRIENDS, MERRY NEIGHBORS | CHRISTMAS | and | EVERYONE |! HOLMES- AVERY MERRY BARTRAM | CIIRIST MAS : 4302 Dixie Hwy AND YOU, WHOM WE STILL HOPE SINCERE GREETINGS TO ALL DAWSON AN WATSON | “INSURANCE * | lila No SAGINAW | TO SERVE FE 2.5420 | \ | _ SEASON'S | GREETINGS! 4 WDA TIAPPY | PROSPAROLS OR 3-1050 - Eves OR 3-8001 NEW YEAR | - | THIS SIMPLE LITTLE GREETING | TO EVERYONE 1 SEND- | SEASON'S Merry | : ae GREETINGS! | ristmas | A WARM, FRIENDLY | MERRY | FOR 1M THE SORT OF FELLOW WHO WANTS EVERYONE HIS FRIEND! NOTE OF CHEER CHRISTMAS | MERRY CHRISTMAS ee GAD UNEASE CRAWFORD Pa Se SAEs CO! 3345 AUBURN RD FE 2-2866 4 ‘Holiday Greetings : . to Merry XX All Our Friends XXX Christmas . XXXX a XXXXX Stefanski Radio & TV TO OUR FRIENDS AND CUB- NXNXXN TOMERS AND MAY THE NEW See ee 1157 W. Huron FE 2-6067 | YEAR BRING Rarrnsess AND XNNXXXNKN , XXXXXXXXXN S KN NXAXX NX N XN BETH KNORR XN NN XXX i 476 W. Huron FE 3-958? - NX Merry | 888 Oakland Ave. FE 3.9318 Christmas!) May the so. ove sua erizyos AX. \ILKISY CHRISTMAS | Tip Pee ee Christmas | We wish the full warmth MARY M. KIRK Bells’ Pure cee ee of Christinas joy to our NOAH Mt. DEON many Priends, Chents Melody BOB CUCKLER and Neighbors Fill Your : = CUCKLER Cure REALTY Rose McLarty and . 296 N Saginaw BROKER & NOTARY PE 2-2162 Heart With Joy a Season’s Greetings and MERRY Friends & Caetomer s P f | eace Ior | Castell Realty | JOrdon 6-7798 Lincoln 1-119§ Allthe CHRISTMAS! |——_______- Year! | | YULETIDE | | GREETINGS ; \\ e wish vou and Sur «ll Community Smmcerely and cordially Jos ots holiday Casa] Motor Sales Wishing vou Christmas . ) And while atat, We want! Cheer and New Year's of success to thank You simcerels A Roch | Oc ester } for your faith and confi-, Dorethy Snvder Lavender . REALTOR dence in our business 3140 Wo Huron St PE 2-4411 EM 3-3303 MUtual 4-1649 methods. 1 oO serve vou West Side ' Used Cars 923 WW. Huron AGENCY OPEN EVES | | = REALTOR 2141 Opdyke FE ¢6617; FE 4-1540 Merry Christmas! FE 42185 Ji TO MY Holiday Greetings Customers and Friends | Many Friends M. R. HANSON, ‘Jastering Cont 219 Seward to our ~~ — Last \Vuburn Service _f0e Auburn Ave \ - ef, lic oe FE. 59576 We wash the tall warmth FE 4-087) ractor __ FE 12-4981 of Chirstmas qos well is our ain. SINCERE WISHES MAY YOUR CHRISTMAS BE FILLED WITH JOY AND THE NEW YEAR BRING GREAT HAPPINESS HAPPY FOR A Very Merry Christmas anda NEW YEAR! lappy New Year Marbel-Bingel Real | state Ward W. Ross | mits trends, chent. and , . . . 6261 Andersonville Rd Waterford nereliben MERRY CHRISTMAS! Building Hotel Auburin Ph OR 3-1268 | | | | NAPPY NEW YEAR! ; Contractor | fod Auburn Ave | ; . Happy | | 1941 8 TELEGRAPH FE 4.0591 | Phone FF 2.9230 ; = es —— MERRY New Year! Sincere Holiday | Greetings | Chas. F. Sibert ‘Roger B. Henry OL WALTON RADIO & TV! SALES & SERVICE '1430 Josiin Ave at Walton Bivd. FE 2-2237 | To all our friends and cus- | 511 Main st. 1-9111 478 Midway MERRY ~ MERRY Christmas To All Of Our Many Friends and Customers SEASONS GREETINGS TO ALL OUR FRIENDS AND CUSTOMERS BEST WISHES OUR WHOLE BUSINESS FAMILY WISHES YOURS THE HAPPIEST KIND OF CHRISTMAS AND A WONDERFUL NEW YEAR B&B Electric Sewer Cleaners FE 4-2012 Merry Christmas | | ROCHESTER, MICHIGAN tumers we have served) in the past and hope to} Your Patronage serve in the future SINCERE Has Been a WISHES True Inspiration FOR YOUR GOOD HEALTII toUs AND HAPPINESS AS POR THE Our Aim and Hope. WILSON GMC Coming Is to Serve You 5 New Year 7 . Even Better in Oakland at Cass . | the Future | Teague | | Slaybaugh's FRANK, JEANETTE — & EMPLOYEES Finance Co. Rochester, Michigan . , : ‘ 630 Oakland Ave,’ and a Joyous New Year Father & Son Cleaners 941 Joslyn FE 2-6424 | HOLIDAY GREETINGS | YULETIDE GREETINGS From ey All of Us ~ = All Our Sincerely and cordially FRIENDS wishing you Christmas at cheer and New Year’s success. HASKINS Chevrolet HURON MOTOR SALES © | TALBOT LUMBER CO. _ | 1098 Oakland Ave. Pontiac | Oakland County's Fastest 952 W. HURON FE 2-241 Ph. PE ¢-2622 ‘ Growing Dealer srl fathead 6751 Dixie Hwy. at M15 ; ; p 4 ‘a § \ -f . ; i’ 4ue) ~ 1648 Union Lake Rd. THE PONTIAC o Be 4 Si Bs Bd 4) A) bs As as al 8 (oe oe ote Be AY , Season’s x Greetings XXX OOS our ick eee camels Wishes. AXXXXXX . Christmas. andre Wossertan Bee Ou XN NXXXXXXXKKNKX XX! T. G. TROCKE, Realtor XX EM 3-4671 ‘ . From each of us to all of you MERRY CIIRISTMAS Merry — ' | AND UTWTUAPRY Christmas! i. It's greeting Friends and Neighbors Russell Young At this time of the year REALTOR & BUILDER 412 WEST HURON That fills the Christmas season With happiness and cheer | | Happy New Year. | Customers and Friends A Merry Christmas _ AND EMBREE & GREGG 1865 Union Lake Rd. HAPPY NEW YEAR Singer Sewing Machine Co. 102 N. BAGINAW Merry Christmas AND Happy New Year TO ALL | Our NEW YEARS TOO | SEASON'S GREETINGS | TO OUR MANY CUSTOMERS | AND FRIENDS | RHIMES GRILL 67 W. HURON 8T. | ee ~ To Your Ilome may there come more good things by the score | _FOR A | Merrier Christmas than ever before | CAMERON If. CLARK | AND ASSOCIATES | Realtors WISHING | ALL OF YOU | | A MERRY CHRISTMAS AND A HAPPY NEW YEAR Ward E. Partridge | AND ASSOCIATES | TO ALL OUR MANY FRIENDS | | | New Year of Prosperity | The Best To YOU | AND YOURS | We Wish All Our Customers and Iriends the Happiest of Holidays | anda Frank Green Stub Graves Duane Brown Harry Tribble Russ iWenter Dave Wilson Don Weiss Bob McBride lou Greer Mike Flynn Ralph Humphries Bob Oliver OLIVER BUICK 210 Orchard Lake Avenue PRESS. SATURDAY. DECEMBER } hed hed hd ~B4 ~B4 Ge 4) 6s bs 4) ob) 4) 4) 40h) o) hl lk AMONG Atl YOUR CHRISTMAS greetings | | —*— | The're none more warm or ‘rue i | than this wishing Yuletide Hap- XX piness NAN | From us to Yours and You .. , NNAN MERRY CHRISTMAS NNXXNX- and ee | HAPPY NEW YE: ANNANNN N XXNXXNNN A. ELBLING PANNNXNANANSN | & BONS ANNXNXAX NAN NXNNNNNNNNANN : NNXNNNNNNNANX | XX To All. SN | NN hy | Our Many XNNN | ; VAX Friends iand all those with whom WE WISH YOU A of doing business MERRY WEIS A CHRISTMAS | verry CHRISTMAS AND A AND MAY THE WL YEAR KNUDSEN Merry Christmas! |TO OUR FRIENDS AND CUS- | TOMERS AND MAY THE NEW | YEAR BRING HAPPINESS AND PROSPERITY TO ALL PRANK SHED AR D OL 1-751. Rochester YOUR JOYS | 24, 1933 ' we have had the pleasure | HAPPY NEW YEAR | THIRTY-FIVE fs 4) 414 fw € { MERRY CHRISTMAS and a HAPPY NEW YEAR | We | Pontlac for their enthustatic re- our services in the wish to thank the people of | ception of | past year and Nope that we hase | made the future brighter for the many of you that have come to | us Seeking Olir assistance in | finding a new career MTT ee LE LE SMEPVON AUEX SERVICE SEF 406 PONTIAC STATE BANK BLDG Merry CHRISTMAS! — We're paching into these, two words all the friend- ly, appreciative thoughts | we have of you the whole | | vear long; and all our | most sincere wishes for. Jov and Happiness for You and Yours. CLARENCE | | RIDGEWAY AND STAFF FE 46203 975 Baldwin A Merry Christmas _ To You From Everyone _at ae wh) od Be hd hd nbd ohn é v2 = sf bs 8d nbd Sd 41-44 «bd a MARIAH SHAABAN IIHT MAY YOUR 12 DAYS OF CHRISTMAS | BE | JOYFUL | CARKNER MOTOR SALES “i PROM ALL OF US TO ALL OF YOU | Louella Hathaway, See. Best Wishes | IRENE SNYDER for a Joyous YOU YOU YOU ALL OUR MANY | FRIENDS! Who hase made the past | vear happy for us with | your patronage— Wewitsha Christmas brimming with joy and | hope to serve you in a New Year filled with the Best of Luck!! A. Johnson REALTOR | DEL. HETHERINGTON Christmas BILL LEBOLD DALE WEITZEL and a cel -Prosperous New Year! . TO ALL OUR MANY FRIENDS Howard LARE, Inc. Pleasure of Doing ONAN ID 3UISINESS COUNTS NEWEST | = \VIs FORD DEALER | we ist 2705 Orchard Lake Rd. kKeego I larbor and Those With Whom We Have Had the ° A MERRY CHRISTMAS AND A | _ EACH DAY! | : | HAPPY NEW YEAR ; | Customers and all those with whom | Season S HAYDEN HOLIDAY | BRAID . | ¢ have had the pleasure ; | Sincere thanks from us | | 9 iw Bob Frost. Inc. GREETINGS | we e | | 1 MOTOR SALES LINCOLN MERCURY He of doing business. reetings | | for your patronage dur-~ CCT! Realtor GREETINGS De Soto-Plymouth Dealer 850 S. WOODWARD : : Friendanip and’ good wil. we wish ing the past year. It 1s te sas coop worp To | Xae you i joys ® ver tr MT 62900 Oe aan 6-3993 arans | WE WISI Christmas” Bay “tnd “a” Happy our desire to serve you IN THE SAME OLD way — | 86 Je, Walton Soc Nea lers ;—— eee toe , : OUR BEST TO YOU | and Friends CHERRY sagt hace A | Ie Ws I At gy piiiet as ycotnteousl ya ius i (corer csi nan ee ~ MANY, MANY n ov :MErORE MESES TINO ess Humphries reds Wis From AllofUs ROLLADIUM THANKS the ‘cherrice! of Yaletidce™ Sa ee AND JA & ASSOCIATES dependably in the future.) ~ cartie . Vishes To All of Y Roller Skating Rink pen ath con “sriends. 2 ohents (and Pyne geetiprcrmcs pice” ||| TNCEATURE, HAPPY NEW YEAR | -Soeerety tebe moon | for Much Happiness and | 1O #All OL YOu 40 Mighiand Ra a x 18 STIRRING «x stl De Lied ‘elle : A = . extend to all a very Merry PR 3-7667 x NOT EVEN x ! Prosperity in 1956! Best Wishes for Christmas and happy and healthy x A MOUSE Lj : New Year. XHEREN AT. x | Leslie R. Tripp, Realtor —*— Chri ‘a (23 W. Lawrence St. FE 8-061 ; r x MEAGHER ristmas IN THE GIROUX & FRANKS I SAY MFRRY Cy Owens xX REAL ESTATE and the an cute OR 0701 From All X.CHRISTMAS — x _——— poe XXX Oxford, Mich OA 8.3122 TRUE SPIRIT | Maeda EET) Ves is UL Oe xaee aN ee Holiday Nour FORD Dealer | AXXN New Year | | x MORE WE x } | oN ON: — — x Net st s : | | ANNXN — Pan Kelehner OF | of Us ! 5 VERY PROUD a Greetings ! Pe Piank F Allen Scacon's Crectines t FRIENDS WEVE MADE AND + . : ; wishes each ane ye Peano ne Sone w Keith Dexo | _ ASEH SN £ is Wee our Rou eoceD) - ye One Mam wishe ach an 1 ° ery one, ee Merry Mt "Deine eee holies CHRISTMAS To ai] our [tieids and customere A Fee One ner Uae a Cuctoniel a very Merry Christmas. XNNXXNNNNY |S wittom n. vance = May health and good fortune fol- x FULL MEASURE OF CHEER x SUL ; , . | NANKXK RRA ' WE WISH low you through the. coming pee ee APHELATA SM, EW OOD || 284 aE tespenous New) 7 Christmas “Bud” Nichol; yer Heartfelt jae sl Noman Reatty 0) pVcse XXNXXXXXXXNXX | bud swicnole; YOU AND | earule ANDERSON HDWE. XX Date Pal ea | IWAN W . 712s Tele grap kd Wer | XX To our friends and cus-: x YOURS THE | SCHRAM ' . : ry We of the used car sales | XN tamers : -t] NN ; | 1111 Joslyn Cor. 3rd. Wish > 7 ; | SAN ner Sy Wwe say, may the TANKS Co-operative Real Estate Exchange Christmas. sail appreciate cur a Nee > warmth and sincerity of Nx VERY, VERY Po tronage this past year, | oo our Christmas wishes add | Seasons Greetings | ! : and May You and hope to better serve. | BLAYLOCK MERRIEST SEASON S to vour cheer on Christ-! Prosper in you in the coming one. | FROM THE 1956 EMPLOYES C.A.Peterson OF THE Happy Robert Delvo | New Ray Smith PONTIAC | Year That your Christmas be xw Merry Year one of good for- é Christmas! GREETINGS NOVOUR MANY FRIENDS mas and the New Year! COA & BUILDING SUPPLY 32 OF ~| HOLIDAY | _ SEASONS! | ; Thomas Bateman Christmas Alcuin Kampsen= Eva Lane | CLASSIFIED DEPT. | Genevieve Powell | PONTIAC PRESS CO. | Delpha Bougine joyful and your 81 Orchard Lk. Ave tune. GLENN'S MOTOR SALES 254 S. Saginaw St. May Your Christmas We would like to convey Be a Happy One and our sincere holiday greet- the New Year Bring Much Edw. M. Stout * = | * ings to all our many | Happiness and Prosperity t_ ; ; ; 7 Elsie Stragea REALTOR (rends\tclients/and! goed — Dick Winnie RETAIL | | ie ae 77N Saginaw St. weft . | To? seraid \etno Harrington ghbors. Don Bird oO Gerald Verno 165 Tru-Built Block Co. You Fred Rosevear ; Phone FE 58 Season's Good Lawrence Vine art _| Boat Works : 1902 Pentiac Rd PE 4-953! People James Morris | 1890 8. TELEGRAPH PE 2-8033 Happy New Year! a Who Always James Lundgen Have Been Our James Green Loyal Customers . | | | Greetings! IT'S A VERY SPECIAL PLEASURE TO BE ABLE TO EXTEND ~ ALL THE DERPFELT SEASON'S’ GREETINGS THE Goodwill to our customers AGAIN— TWe DakesIhisiWay BEST WISHES! | /to Saya Merry Christmas) 9 THE STAFF OF and a Happy New Year | for ~ i Merry and friends : Christmas| | to all you friends and eustomers, A MERRY TO OUR MANY FRIENDS ; . Df MERRY MERRY LOT Happy You Bateman we) siai en geet ase G. A. THOM PSON . N Y | and ; ; , | for Christmas and the New Year. CHRISTMAS Schutz ators & SONS CHRISTMAS! Pontiac Retail Store ew Pe rL Bybee ENT | ik r . ; 2 : : ai) Leo J. Walker : : _ ER ARL W. 2 65 Mt. Clemens PAUL D. HAMMOND | © : K | _ WILLIS M. BREWER Birminghoss il CAREALTOR Phone FE37117' | REALTOR Realtor aE sen (908 Lakeview 11 Roosevelt Hotel : fe ™’. - ee B, reena * _ FE 28632 a | - #l ; |- eaity an ‘ : ell Cee, D tne fe oe oes te - ety ‘ : “ \ ‘ ( ea . : RC - \ I. : { ns \, , oy ‘ ae s 4 : in : i . ; ’ ‘4 aes " a a a eg Oe i Os en THIRTY-SIX THE IAC P é . DEC t\CEMBE ‘R 2 24, 195 5 91 1 ed F sno Foe Sale. Dress eo Cothing 56 ‘a8e8 . Treason. ae TAIL Sale bog os SIAL sco. re “. Sig ven _Househo to 14 SOUT ee ae 16. Very l Id Goo is galas aa ioe ‘sed Tr: s 57/ F F 8TR FE Also me 1\* nge ct rade. or Sa STRIPE SHEARED SEAVER aim tot te Washer sin Dept. | Je Miscella roeny re hue, Mus BEAV! Aperd Ran , Sop: ae FUR = neou: Se st sell Vers Refrigerator oe BY a) ip suome and? C s 60| FUNNY ny! D , rie yg Bg SCE neal ke et OM =e Hay fo RESSES Dav ran, -: all hood PLET B ay Davenport we CASH COMPLETE USIN 3-5 worn. rop | and ’ ie FOR up. 7 ES: UR 150 twi ron ieel cha 4 4 | Bai, 3 - Ss. “rOaT siz ce imaboxa table ven 39 50 DR: __¥¥F RN Gey gaint “gor Ae ee “to. $35 4 The Nea and four be = Si RAW af ] oF E URE | “—_—— atic ae oal coated AND t) 1( yM. conven pai | ROME ari = by H are ae UR WIN- r aS E teat een The EOF CHES ershbe: iF and o 14 f revle U R a i N mas of kind LATE ADMIU S| rge Sale_ Lot ao” Living rooms 36 NITUE OMY | = makes, ea tM yee Househ « room) USI PONTIAC © aE CO, Howland °-4 to the f Epo o For Sa A RAR old Go USED Nore he w a . | FIRST OR vis is Ol rame ¢ oe REG etl le Pet a GAIN IN, ~ ods. 87 Basher POINT “HIGAN tubs QUALITY {3 Disle Hey Pek: Ses cee oe E t M a 30 Al 5 5 | zeoisveny ~ bo FS bp! x 2 rE 8 PAD He $28 #5" no Fists ed eee Tl need ora 21 deo rede BAT REGISTE. aL ae alee =e For Sal Se eis ects papioe a 4 ee Porn a vee Peo aneata toubie ae eee nen’ ERED 3G _FE 1 , AND le Ho = rah deaanase, Saree se odisert ta 8 eee ras ae ea x ee ME le Housetrailer ode} ek ap ow liver q BRY . 2 0W , St | try Must * “a oe 7 _MY 3 A- Aclae Wack rea: er AN Hu. roked P vLS : be 8 ond 8 eae poe ae aber : BOTTLE A ome ams I MEAT fit da cue ee s.78| For Salq Used noo 9 Phone Ci Aa eS mesh ame =wl> son r r) Is ti c ~ w _event paid on FURNITI = <7 a! ~ YDS aac at Munro ioe Scirai a a REOISTERED Comp. stom, ‘acros Waite the time to ~~ Truck venings pilance THEOANG inal! N wool Yani (Gn i ef Roa: Ke sue _ OR_3-186 s fro The pure 5 APS IG 3s 90 ROT # OR an Bp * x 098 8 eon ae ound = cet ee aren BO rater 5 5 t PUPF sie 7 _—_ f Mobile M Ss & 56 We s aq erm 2 si eel en 1A ¢ ¢ es ian TL Ee 6 __ RINGER een at ee - a ore Lars bacor $10 mane Val PPIES. atau Eis ile Ga i U Pp ; _._ For Sale Ca Ca lation 0 price 5AS | Giese TYPE Perk $6 95 21 5 ioe Oe aiste PUR 1 bile Nome on oad Pore CHE panes sate 6 rs 9 Meet ORLY comn “ets0e “0"* we yl $1 00 RE E 4-003. LITTER a of . bo F600 dic. LET, as 1 le 3 SH n 3-1 D COE x. B h 195: BR \ OR 3° mae ges at 2G oe Y. R EX Cone Kin MAR af mercer, after KER P De 85 $ ot poe “engine =. ones v-8. 4. 4DOOR é ND x envon ; GOOnuRE Cal Mi 1 Walton RKET Best and c YOUR CH UPPIES. Mverea . . box f Sooe uae : Rai os BU - 1K WES Call REF FR FE 5. at al co age on Also poh and Eng . Tak co ngs . #1 sLTN &P eSTUN epee yseat PEE aoe OP mpl whil RISTMA th se ine _ Take ov INV 10, 2 sturd kK BED Ot 1 see GHOUSE es aes LANDING pep Lt wiiatchers selection TAs ; BIRD room ‘asia A % up. R ieso er pockets es tatse PREP ent cond Hh ersgs ee on ro TOe = gy | TOY FO 2489 Fe el have el ni ue | dio, he ars petit Ath for 44 93. ie 2 ome il an nd, $70.95 enc! Seen pe coi sith TS $19 6° oe Fi Old. PE S18 avers nal =| ches ahd and 3 ER pioedieegg 4 R IMPERIAL. aor 1995 each iva Fittings a 196 at le mC LS tr ae O i) a P €: Shaun te iavimal WN Lic eno ink avenue. 56%) RR Dogs a — d canred eilers 4 isplay. mace ME tres, a0 Lo 2 only iadde ~ Al il M1 or @ ls 1 P i EST! Call FE Good 2 Ore © B $l w Bay |B atid fh) ee SAV Sex wit 4 { ra KS pid he | an R We hard ank | ceokly LOOR Dn MER 172 5 ort a 1 . ined. sé plan iow 10 be ou “FOR Mc Ol FORD We “Give cold “Bel uemitre Sea te See Sal PRIGIDAIRE MBISG SC pay “ peer ay oarded 70 | I1\ Cea xo rental) 1H om THAN Deere lew ABOU WAY = 1a 4-788 a4 94 ; Pees $1 HE ed BO Jy HC. CE 30 T 8 P amen Hegel Al ’ ELE FE 5 _fraph Nur AR z = W An Le YRs. CAN A woina ramps 54 95 Spec te Sa Pept Eos CTRIC R 2100 r-Shell DED Z AK ODE * re G End , Beate SS ATI , $319 95 Syreca a a tr ie Pris e heat f RAN H 378 poas N . Pa E L198: BUY" 1t » bab UN you Las BAGS ely en er g2 / e ter $35 OE ee ay y. G s T G TER E 1 On fase) Headl $1 dD? WANT ore RCA eles ner a1 { 5 OEM : irain ele- oop AND 7 eT prey testes ' Lea 5 RCS a ek en cies ae = aM ae fe n& O G00 Tm: raped ‘ON ] i peineerators | Uae ieee Zenith 2 7 t9tt Sree stare ob LALA. A Feed 71 ILE a. at eae HAVE you ou ees ee rs os ee $274 9: Bendix teat es Northw a SOG —— grain LL KI H OMC TRUCE 3 70 BR LLEN N WH SE os i . 3 pees : aa - ob ND $1, TR 08. T CA EN EN tists uc e oh Fe all sizes| cad es Oe te Sey GAL 1 corn rs pharoened LE oo 8 HA MI eee Hata er! ke edad Say a TURN’ ay cet rome di ub. IBC sizes) ihe eee” Jon jogs 36 Gal rhet Walt d now a e YPE: corn. Y. L 62809" TO B PLOYM CAUSE NO TC ED penronen inette sets. ere eps: Leo ae Ran ye alton rT ie od ee _— MA Drayt 601 D 2800 N PT AD C ENT. Or Bi BUY hicne room new sets ae 89 12 fro y. 0 er $19 § Cab Aut cb AO a deg US 83 deli cuttt HA ; ray CK-t w REDI Eo su0 oueanen suites pores Oe [21 ONT sactr lacy oth go 95 | Sere US 1EAT pay k came 9 ionic. ver. O neg Y. FIRST & Pi F UP. HAV T. ETC CR RT otter ims Beir “822 f95 un 71 So _ mee Dav rae res eater i .. “T reall — fe on SECOND re e219 . atrew, Wi M 2830 8 si on “91 we Sale C THA T ® a 9000, SEL men S er el {295 up rp vs, 3 te 5 2 > ally . . UTT i Lege or LECTIO &e “Om R Fr syY Povo Mant RO ‘ hon ING seme 7 INGSHEAL wand tarts om us bormake up sot to be ena a erase ‘emocni and | ALPALA. 0 ce B sper usbdee Ll - ( SEE 1 fl ae 91 eri ran can BOY rs hoe LAY-a-W PAYM iy) Made YOYAT ¢ eee AD V Sagir 23 99 nym ac — ter 2124 alfalfa alfela —Tst ce 1 Boost ES R int aT -E THES io TT oA pow put oe trad AY PLA ENT i mm 2 pte RC yl oor «out, Ba ARIETY aw st . ind wt onduct « §-1039 Bilve D. D brom Kase sian d aor EPAIR Le OV LARKST “Sie AY MENT: An ee eine: ae anvthi re tables rece suit paints pene ldwin. A 8TOR For S len L V or, but STRAW O rbell F Popes en Sho. tor ings ail VER STON 7 s Nor D ea ound nine Mean af ee atchin je, 2 mod HOTP: epee Armstr E r Sale Mi was are it took and OATAUAND) oad. PE rt. Fe sss called HEA os LOW No 45 EN DAI 2 or-re e ALL rator De sdert NT ¥ lon ong Misc yWwitt »k me | _and necazi ANDICORI 54350. trail “AD SPE Co-Si as SUNDAY. 9 so FOR : ifee: ts bo) K ue a ae Lac; |’ scella ae 6 MDS : too | | brome, cutt: CORN. FI ers. PI ee EC] oigne ' eo8 SAE 12) = Lite r) ONI : 697. ) bow «ms av te PLAT al 3 neous ' ong at e. MA ing ha . FIRST le TO SA RICE ALS In : rs. sonlias or s co P LY 82 "1 \\ 4 err aireic E IK i: MeING 60 C _ or Ss ple 5-4 y, alf T 196 VE T - imed rE Lie. ral my Cat S21 : ; 2 Bet is FE 2-062 ox ie VS Cam a sale 784 alfa e 3 on YO iate Deli ‘anes OP AEP ac Stee Us- | ent 1 pen Su thru 8: 50 MAS. ano Daily adio 2D e FE lots a Oo on's B COLORS lar NEL | etails IN. Cc | Interto ne ate ok a 19000 M 0 een aa ipoard 18 SO [oe 9-267 hone CO 5-1908 cu Tr. i indav P at . TRE ‘514 TRADE Pose Neate RS UA rte We rchard ank F eins ELECTR ALL | 2 r and d mo nd Extes rt oak f) 3165 M $200 c 8 5s fe *F o 6 live. CKER PA a iler PM an ee ICK oes eres ND « We Give Lak urn xcelle: ceortan as Rison: if eat aldine stevicr, | I: a M M “KCCO We Seana ET Sele fart 2% G ELS REHU or Spac | 20.0 le KX H \ @ pain rin ford -0- “DRS. CASH Goid e Ave iture 4-4367 nt Ch ent of TRAINS. k and nders evior s Tr. lee $230 RDIO Eves _ St wn ow Far __ oldner Strict a ce ua t 000 a & one Rk D’ c 305 t. Ver whitewa FO! Bell_ FE au a atia ca eel AINS enetn aa doors ! B M. | colors N BA ul oo A ‘etd! Produc ro ly “TR 9 e ctuel” aitio: OP” H y cl Us, t er tool R Gift 4-7881 eg ATIC ELECTRIC? as ipment | ne Pi floor nd oth UILDI Bid | int re LE PPL S rod — ads mode Al wi dark mil ner . | 2705 OWATI ean Wo 8. penghall Stam used ATIC E aift. nt | 6120 ‘aul Pine & ing ers. 161 cs st S P ners ated red ALL 8 at Fs A —— uce _ | _Shopptr and ern LER whsiewalls blue es. Light ery Orcha RD LAR Ouly FURN Ps.|BO d twice LECTRIC & MI Boa! SO ee Dae hee IPPLI | oe bie Loane TYLES. | - ioe Lso ——~ 75 ng fe facititi unds. Well’ keu Hearth slike Rr th | PED. td Lak E INC wholesa FREEZI 1. ITURE| XER POP $8 RIC 5 A ake 3 tee | = Hwy 311 ES NEW SF asem: 8 rs to [peake The CIDE oe flitle Beh ke 0 bell id eee y. Ort lue 1983 e Ra c le art ar Poni ne awe KILLET. MONR Ack mber C | 'y rR SPIN ent a yawar be. AP rds. "R. A 1; MY. ool pt} Pie mosiai have T ts Yo gina) haa 2 TON 33 (= ) RE ; ran FET ot 5 PLE: 460 HOM uto 2-4) bus. ce? it It se utr _ cond! ler EQ ee Whecads THE MU Dequi: AKC to ROE 3-2731 Coma PAIN —— Clark $2: teh PY FE 5- | = Ww oO E. Auto Accessorie: ll Oak! Pecotss thet th th- tion Ford REE Bid eee — ted “lg nerted _Miberty ze = REGISTERED he ae TOP TRAILE mimeree tag 2 — 130160 oe ae acine = arms "WALNUT i: rehard | w, AU ccessories = oples Auto ‘lean ae sere My 3 S60t ee CHEST A savings. __ 2-$887 LISH ns Rd ONE a. ILER & 2%: 116" lite $ ENT BASH 036. OL 6-057 rodu disco | =XCEL iddlebel N FR eee Ou. 80 51 es, ie ovaries: aS vane ood — 22136. aw cut BIK shen 1 bed OR Bere A yereece o! a fs Co OL Tcsae a Ss our servic A88 s_ 80; ' y FOR ay off. balas ND TE aoa ae pan al r Ct RAIN. (s) 2 3 ge 83 each DS — ‘0 OL | 00 H T co Tleevieenn SER ean bal WIT DRYE Wasi un’ PUP’ $30 50. _ skal nicke w R > Hie ey 06 : ow TRO Lj} ad! RN you w Mees Si vic RD ance H R, D ditt H- iform PY $5 FE tes rE. coo ATER COA BLAY $3 70 each i 1h cas MBON ore ey Rd Te All ait. I Glas. ave 14 Pp am tine, Vo EM _B. Munr EMONSTRA bugey. | Add, o GIR TL 5-14 ye OE Over ayen 2 AL bu. VLOUK cack — e. $75. ae hs PARADE ” Clar CRATE bale) Aotoet meurane faetetieat trina ne ee > ie «4 DOO ‘0 Bisctie te ae E| _ 3-488 aioe elon IRL SCOUT | 1 4 NOL -EUM coat. Ice a UILDING Ls uae TUNING" ey seasrctiac i pee FRESH kston. each door euarantee obs ed while ymouth Tet” this = Rien 060 coat, ab FLOO TIL os C ake Ave PLY eed ¢ G6. REPA! r 6! as PNIZ. as i = | led gia us ree e : OR! one good er, ae STOVE. Sion PLETE eri | Natl ats Aneel we sde Y sofing and S Peace, | PItN Ne = Eeaeul ED-3 Nene | OS Berori einienk 1 Ib ar ee onion mules __sexomy 3 eae Ba Lro T bolts TILE D. Co g and a ELLY | | ‘ne Oo 1UN 23. OA RS GU | Proce:sed i 32¢ 3c PER HS apenas Windshi with oO FORD cl OTOR , 1 CU. FT. MY Sa712 . Ba ion CALL FE. 5 N S) om bad Las mbinati Sidi R “oscar Schm OME 329 consed tr cour Sen ‘2 GA | 2s ee Au Ol eld in- $ p “fy Tee SALES 3377 Saens rE TRAIN MI £ZE natio ing ENT r Schm AND owe’ y thi ur oO 2 gal Lj akland uto Unt vt M MER nas 1 yea GE \GIRL W Se) ti 5-504. our. THs. . $1.69 8c ] n Do nN aA SP dt FE 2 ‘REPAIR: me Mi poe eral re lion ne Glass ne 49 FOR ¥ 2 CUR neva Apoot Ex DEEP FRE! Gicegtels incbikET 2? 'EIOS 237 c 19¢ GAL \ nsulati ors paths for ney a 5217 in. | Blvd d 2 om Gaicy of eats lie 195 G Co c OW best ORD an éll 9 PIEC 1. cel. EP FREEZE ngfellow BIKE. $13. Ssh I Sa GAL. | 549_N {_ A. ton wie aati ‘ET OR 2 CONS | HUBBARI les no 4180 gan 950 CI FE ¢ ashor T nN er, oie on '51 PLY ———— aa “ > AT : fe) BARD 8¢ rth Baid IEV 7066 r Tri “55 3-5 ithe LYMOUTH. ditto E sEctTI ition OE _ BNE! i * & AN ginaw RC Sagin BENS nar go as i All Baines Reaso, LE | pes RD ——_ ot Walton “V_P 66 THIS rade-I Ban © Put GUTH: _ 204i crower aos ii —— A LYER ° MERI OMEX ~~ ON ahosang a cone oe eee | eee auidic QUASH, BL iad AC =FARIS Wiel a ute n Foros ce vate om me pore D con -ADIES | heey 2 TR - CAN foot. W BY EO $10 gany © oose payment in | 860 Giddins nts @ pou RUGEMOR CCES S& NO NO 8 ONAF Trad matic NV n- TDA tas. FE aS) | ee i ZAINS ae ca Mala Soh ee Por mon r Walnut. Ar | ae jiadings_ Rd FE Ux O =SSO et Le “pert or Baits. ONY. FAIR Sean Gon ; SEL @ | on fact icc NS _ $995" Main & Ore 2 Sen pease arbre eines | F Otate dF} Aleisen, RADI R es Ae coer Aein Papeete Ho wine ur LOT factors ry stviee $995" GA tor d 4c TRY rene? Pace an eee. | $ ves, De E 5-6 sizes 0. Hi LES FR fp Be se asd 32 8 nes sagen E. bape door Ernie LORE B 11ING _TASK ory a v par rvice STO G A & ran uplex PER Y BE ne’ FE gher's, piano. | 1-83 elici EAT a ANKI EEDED OR CHED FOR Mas ewalls eeliegt cond EP RIOERATO er ees NG ERS 6.W. tee, Salle KER yrange) a6 See | oo BEECHE 40566 1s E jmOrions out Bald ious Apples AND M ER, RE OMPLETE B oD ce BECOND. ae “6M urek Mo- cond: Fy Pubdedeads R DIES SIZE CETAT M 7 Ww euteat conditic STOK mopson boxes ovtivs gan fre You Ss m Rd Li win ppl 1sc ARB TE B T Mr co D Sig | aaere AINE! YS ° rs ol auto- Ol s8U 7 E \ Ht med an, KAL _ 80 eae de ates 0 BUY | 3a eft to es . PA UM ETA “1 lights en ore a FoR aE : $150.05. ony or | See iS | Beep aE oe PU ion res ae with oll cask een | ae, Sy purchase slater TREN | Sale Farm 2 fee a on wn Gr 10 PER 611 FOR | ‘33 FORD a ee oe fe as mbaanply UARA 1 4 tr 5 30 © AND 10. k and up slow ; BRO 1 Dar id arlev D § g but | Mat UCK OBILE = Oe ette set pecial eM cee For Thue. _| ia 8 "er | om pe Ried En pl ts $39 c OUT 6 JOHNS PON R I- LOS. 1a | —& son David RV t “\ n._ Roc DFA . eed ths : s SET «| Union Lak port- | N l seumeee csics||2 caaqeienayaa de faucets ih ne oe Cie ore MCC on ae Ce = egeine Gales Con ICE 0 Ve nester ER gate FUE From snes weeds ne Lake Rd EW AND ING" SUPPIN compart Sea thane aucets $29 50 ua Ronny or SCUEL CC RD AT ALER Boats & rae lle , .D Drie ce ‘Side rot Ro fom $24 ee Ch s N ATCHE: e Rd. EW AND = UPPL ee and partment iauce with ae 30 c ght On ors a and 6 H CHA OPDY ats. & Ace 372 ibe} D Drive ae e U ced _ 19761 gas cheval jae ee $49 95/ —¢* ristma ew Shite BP heatin erator SED | FE 5 1 com aucets Ceme 8 edge SAY AT Dasaw | Sutn eel em IN SAW KE Ac th A Sh have hereca ri (Gaga es os... a tr 4 s bbe ALDI ter @ and Ss ee FURN -2100 | and partm nh wit $29 50 ‘ BAUG ay uth & La at W 8 D cu cesso ae the veriic ree it. aris NG Neaters foe of ITU 1D fau ot Cc host PE 630 AC file Ww wn E F ROP RIS ssories W mod diffe ad is Fu Lord’s up FE omen ai TRAILE = f ik st nd el RE | 5 ur-e- ce ement ja 8-0453 Oak! (GIUS mn Ra ward. ‘quipm Mille we TMA s 8s : et Si elal to rence low rit r oh . AIL ee na pe oves @ ectri 2 GC tub eS with 23 50 | “ME land A none M Bi iN ent, mx olve sUG l,, 32 W Sid to choo Man 123 W ure hris ft ER_ = Abode po be al aman cith f stan y RRY xe 48 Miawenmeie Ae ricer aa ae GES FOR Hu eL ve from. Huron and A tm u NE XCH! ailers and ES electr aucets $17 3e We w ~CHRI FE_ | sere ace et 46033 ail pe | Sain eather TION 2 Gee R OR 8) ron sed Ca om: “Wher St. : ppli jas T 2 in. wo ‘ANG and prov Edisor lc Ww 750 Batu ul be STMAS 4-0824 | end | TRACT 3 feb eath OTs 2 Old y hard - ALE ars e wit iances |a CHRI rees | Me in 1) ALVAN E FE @ G edi 5 rol o water need rday t closed $ TO cre erecee: re OR W wae ercraf Sa ated 88. top 3 adic he —“IpaT FE iaueT giey's Use FE | = STMAS 2 __ 59A 1 (M1) ft. le IZED | _2-3200 ay allon ‘onsum eaters. ANDE o bo from ALL 300 ca ITH F RA Vaya OG t boats "53 stud~bak R& a oH jaded _ Portatl neater h OLDE 4 42188 aT 3, your TRE lat SAVE ft len nghts PIPE 66 ear ere) ers ERS clock 12 n STNG ——_ sh Ph RON 18 RRIN wary sears Sy ‘adilla cris ges _MA aticg a1 wate 7DOO LA ol o Be” mont pl Ag TREE YO [172 8 8 PLUMBI ths Gato c wat ARG 2 XSON Tueniaye JUST on rE eg ING TOR or Teron (33 Ford c 62 Sports ore _6-2535 $100 or b Good R _Giton, FE refri E Co le Brin ve tree R YOU a Seneee ogee ft oe nm elect er hocen S 82. 8 HDW day. LET U RI TAL ¢ on ta OAT wh 2 For ve a ell a cou r MA oe oa cone Man FE hd omy |S) ciyeur own to new x sure * 1 * trie w sil 50 and, _ Gri _Teleg E peat, le &F l enccee pb wOR “83 Willys. pane nes er C 300°" OGAN D Soca con. ering Ti Village on eee | WER nue = Ade im an onsum siet heater ra elesraph : Abbe) lat AIR ‘ARM is RCURY ves @ abel a2) Sue ore A Hyd e : size Y B | daily x right age on lea we ‘ools | ILLER MO p vue E 5-2 plie id eight er o eater & avel & ae WE WEA EQUIP YOUR {) w ja M nd_Sun = 32-8033 1 *54@ Bi vy Be Gane ra Ag bons aarings, BED WITH | _Nurset We 6 core gravel road: A depos eb ala sa pliceg mith > ine r Det -i TOP 80 ¢ Dirt WE PICKUP A MENT TRAC- cceaki ane MOTORS s. 33 Chews Beas olet meth Fleming had FU | CHR: ry Mee Ore turns road, payme: sit © WER ROT hina mor tub s h 2 val 119 Sand, 1L. c SS 66 acne, Apts be WHI Vossen 6 rete 20 “AND ¥ “$5 Chery per r hardtop. A 956 —— - aA attres LL | ISTM tual enridg Open Gard intel ay il (be SPRA Any oe ae pout vo sii FE & gravel. RUSH See: NCA D DE LE | MERCU e Se ate 20 Parc £C| ene ~ Flee, ton i a D BUTi patiress anes HRISTMAS TR +2038 Geen | anc pa le a ae ee eckem ub fa p BE eee? Pie ery rae B ome LIVER ERCURY Tes, 2101 Onder son FINANCE. lees poor el ‘ _ An ee WASHI eens | lates aap EES, m | _ Mil ane ripe oes mgd Gy ucets many es | EACH 2 ore rary rstotad | H Wy AND ral ND NE _ Sales & our 2101 Dix er now. ECON NCEA rics 4 Las CARS oO ak Ni _ ton, sD $1.00 e Rd. Sere te Mil type. etn a We oecrn cs un dirt AND _2-8572 ‘onk lt OUG Ds w | 20 PE Be TBO. ie_H ON ARRA chea cou oF S ‘uaran es. § ‘Ga © h Pt ruce ) A Bi ard qu ler. P to: f k tv ic t F G in, | 882_N GE AVE R rvic ARD wy. 2A {Y U NOE v. RTES FIC tee 24.95 MACHT EV orne me ND! % NEW G. rmin “4 ipm itche p 8 aucet. ype Roe E 4 RAVELAND N. 2 1iTEN N AT 105 CE e FE M 72 Auburn S D 2 DOOR ESY TAI zontal d. Th & NES | ERG f Aubu Aineticnncts tn. Gal eham mi oft ely ad upply a || es! ED 3371 EL Main, IN&S beth alls ares: CADILL jSED is CURT SCAR $39 Johnson. yle up. Pu Reg. REEN rm and rican Le- % in (2 tt -VAN! foi) A empete amipese aut! STON or FE AND | Sale | Roc SON end [bostannew FPO! ILLAC, 1985. | -D CAR: Pont = a 05 Ani lly, © 70c ‘NWR Pad se (oie slenatn IZED 46009 | sbertsercl M p-on _Ear E, 8 5-2 re mE nest ow Ou NA . pow Cc. G | 120 cou Ser, ELECT ric, 50 rave ro EATH: dock. SAV. ft tbr Bs PIP | le os Pp Don 37 1 He AND, 749 Farm er 0} EN tbo: LL NE er 985. 6 __FE4 UPFS RI a) no ae opine: 8. 100 3 se paar ef. Sra aia ana! sit F ewe te | JE L197 3. Ms ard wW peeer ee 2. + 4-213 ac trie, iJ c Ww. use anke no ~ $2 8.8 PLU b 8 cove aa ds _ROAL F AV- Equipn 61 396 AR moe Ab dedhed 3-032 5 G E + AT ipm Or fe wy | ‘82 a0. iles, R. “ a Rs w. - Munr RH byt Ever t 45¢ IL 1 ING ch. iy als i, 30° 47 _’ 00 4 RAV 8493. ick en pOrenar SU CHE 2. ALL 8 Goce PE . Muro nro EAT “sco me or pees Trees yd ti BURN LEMBING 6UPR cen tt Pa al pipe, sin 5 | Vo eliver EL Sa 1. Cl t 76 Phone Lak PPLY New VY 600. F IXES BEL Es sure Elec | TCH FE 2 s 444 The ion. R ERS_ ely 3. Soi] pe, d gle hu I od, & ed. FE les Se vain S ALUM E 2 e Ave. ; pela = STAN & EI AIRS 5 rn IKe oe ON ess0 IN_GOO E 5-2 soll pine ouble hub $1 00) oal & +6588 MCCUL rvice Rent aw Coos -8020 ed Tat leet loos ramane GHTS Ores SUPE == cu seus CHRIS E OM mabe: D CO 100 | 58 { Bibe, donber roe ase eka b Me CULEOC Rent Dist MARAE RAL AFT BC $1 CHVE fotor Ba! et R at ple TRAN: dood te IGLATS eos your Peas ret TMAS nace, — BURN 73:8. P NDI ee Rece double hub... $4 oe | _ 2 ive stil v Fuel 6 eae r 7H CH tals MY r. 422 NE SA 4 Roronoe dio, ROLET te Meme, Sa CAR oD 8 Good aptiolst Bs) lew (Pate uAueon TREES fades med ING F' on | Mars Cocaibathiubal as | Dee cnet "Deliver ‘ 7 Att 6s ‘a eps SAW f_3-8821_ 12 Fr ‘carne ‘ORS Aeceecar ht a can GUAR RIVE - LOO § 5 Rig Ww = TE & SE Above fe, 2? DOO LOW ANT! Wain rocker ered ch Fo « Rd 42605 mav | ( a line ce pe m R FUR Rear Poll tubs, “A” $37 Ad SLAB elivered. 6 A CO ine repens pede REN used ROW B LEGR RVICE _ to s aver directio: R 1 AS EB Gamece ior a $12, ~ t Sal walled Lake GD LGkRAGEs oat eine I Jet watestoas eck yeu ual. | F for_$1 Lee is RD, | _ thine AND U fe ean oar aan = FE sia seoatiia ene ruut PR Refrig, 1k ne ui le Misc vane | ae ARAG onable OR One| Deep. w mp Pu 36 25 Sa . $6 PE 2006) | cualfeauioes . U 2 BoA Tene 8 tate ee | ition. Brice NO FT PRICE eee ine dresser $3 scellan iene iil) Gls OR 35029. Bee Ly ae mps. 1-1 Git wee meted R CO ery Phsces (0 SPRE ra eason OTOR pects ROL ares Ticed | BULGumAsae ; ! . Sb 1-3] end- es at _FE RD. hgh: ADE Ins po! able. ma ET pm bow NG Biectri desk pew bane $18 ATI. S eous 60 Tern Put. in Len PAIRE ae cent All si allow $39 50 ond ipeedw NNE +a e Ort Devis Re. rta OR F pped upe P. = a NA PRO rie § Op eeStaNT PO ns FE oy he gthen D T ade-in off w res | well _enard 1 Puel ay F L co “sae __ Au vill CA ition 2&1 ow ewer! ‘ 1 ND U as LEM: a a peste SUNDAY RTAB de abicereranc: oF neceameen” al eisch ace HA te an uel O} AL ctio ¢. 45R2 Rs Off 887 aoe glide IR T UP T You r elect $75' Hey 0 10 27 AYS wesder | aa Tarece @ Lie OPEN D they 1 il and | HARD 8 Ke Ate FEL il, Oak. oy n Sale 2 To ered arr eaves Hee AKE ty eh pelecins . ae Vw ecehoa: : sien e fs ; ors EN ast. | __wood SE ve. FI 436 ak 10 = s u CAL 87 Spm Cal fet Cle onten ae thik rie plate... -e ye gence ae Te eat ECTR DA No.~ FE ASONE E pel) rey N, W = 77 _Dixie aera di all TOUR NTAG THS etce Gakic ; ae AT ane ase Dai PAINT 10 Parkhus pale eT avn Vex D Fi 150. eee EDNES A bine Hey "Fi ee Gh balptalldi Ig oak Ric tering Ts ATTE: ie ae) ron a oun Call PNDAY f-oP Fo = REPLACE iuterd/sts dileay toe LL aig cot ees 2-0878 rapleed POnhtoe the pavines 5 $25! II MM ENT _ e Also Beauti YOUR FE 2- oe AR AY \l Le ep ———— E ae atl 3210 miles DEC PONTING: LOS 2020 Q AS Y SAV 10N ° A > aes 8 ful F 69 mm 10 A ie Jer o'cl Gen we: TIAC DRI ANGELES GAN ' ou La Eas hit everrthing s| at ues B a ! M Knotty Oak alors ib eal Sains). i NEE 2 UNS [REDIORFED Pets s 69 Set ce ral "Afotors Los Uni cart Sethe a SAN 1N1C T | Don't cAvED "BE NEVE ak] ing f sel] an for) in used ee seve 3AIN edweedioane poring § gal < i : pup a PMppS ECE ea peter with Gace made AN Y 85 e elay ORE 48° and F lor th id ex-| gs. U umbe eral i S ' pan pane! 130 i P \I a | Sone AKC FE 5 140) G MAN p Bru: al Er penta modei Mond Sait ee RVI y= ‘ 4 8. Sagin urn e hom fram poe sell caractlnes eline ing O le vt At Cc DA 5-615 olden SHEP acker int dis ia ater ei | _e% ay BES Vv FE CE Act T it ei f es Coo at f ne BL 10 4 $140 | R] » mal SHC Reciever spr Cc. gr ws 1 two chan Take TA +5139 i, ‘ Tod: FR co ure | from ap eee aN eae BU LACK n.. $23 Ly ON es Hen riever | fe ate ain ML hy LEA ged. tw PH ue room ear ba $71 00 ON omph 1 sav. UII KET 230 TON Whi BAS F pb PU er; Dalen r on ‘ormi drill ole VING EM 3 o R OENIX ] y table. set. $7! 7 Fina FE_ 2-55 | boards, se 3 wine ew mpiete cea [DING “TT'S I] LLE SSET P Sey PPIES 400. b mixed ee . Cults: Dec. 26. 7OR alérenc a ask - Blond x Me One CE LIV 20! @ reathin eilin- ssulation, FAY Aa 1 | 8161 NG SUP : e 0) ae ps ae Gent re ae alex) at hay r eens __expen Would aa ins .Floor cheat ot pone ING | “ at erent Je. felts, ‘building Ditte Hers re JPPLI Seen 1oOr 50 AP-15 Adin AGE rea ae ae ies Bend be : eEC aa FE $- cpperd poles tet ' Ch “step lamp, of 4 chair room windo: argain door shingl ® PE N wr 58.7 IES a e buy 1 10 MP-15 AS ingen! AT ST FE 2-6032 AGENT Milk epee 500 crat oats Ge Goin A er to LES e eV ‘a0 table $7.) rawer 8. $25 Prices we—m prices hard es, ln NY =! drums and 5 OOK! > 6BO ch. Nea UD $ * er Maste ric b chicke os of |W eith: Neo yous et to share ] Oak To All s, and 2 s. $15 eye and {ll wor Use. ware, | ‘ous Pp, _ Cla __2-6432 H P ell al Ne STONS _ r Fa 1s. NOT. bigs er 2 attery ns 5 ANT er w NORT lan . et = plete in good Meeneenn “UR cave) Pace Guurice res e paint AINT rkston at eae __ OR 3-929 AT etn ee SHY Sis ae anit_m aoe pe ED R ay FE h S d Co oe for $ : coffee eany, \ PID INS Pree Get ck | T aultons: 1 iS Al ton UPR of st le 3-9296 T sTu _MY 3 val Moc G too 80 Ibs ilker 6 er mses IDERS * y Sano G unty’s F VES. 150. 5 ceiticn Goa. MATE re Sale) eatimaien Sa ealicee Fallon ALE aN Sy Phe ney | HRIST uD. c 3102 Pr Beane s Ma: feed eee TO TO y's F chan - BO 4 Jac nm. Com.” ATER . AUN mates | Rubb allon. le Sa08 kK €C a MY | tere MAS SAL CURT op B Evan rous ny oth _ #45 vin South SHAR win aste me pous tton, Com: °° -RIA MB trener a; ah Po 8 CABINE ISTMAS | SALE 188 | Pron a eter to mention, Reg te fo SARE 75111 gD st mene Tu HT : High ATS ER | olle ace Gal ? $3 98 INKS RINE De ing eagle LE = *- E ter o1-M entio ec 20t ‘Alabs EX. ix eale Hine Pe on SOLD, EX A and Rd ALES 11 gal. pel paint. eal tr FROM abo Er) ing owt SALE 8 ee leona d. Gottechalk” or Farm Ww " ! mm [ a 4 GER 602 ae =e ntrF Rd. rESIG ar paw a gal nfl] jelwate M tones 6-74 Between 37 Dea al beau a | coMM Howe’ achaik Tord Kent anted CHEE M wy.a chine CONS! Clem, |G ree shad | OR 0. | FE oe MES gas heater esie es Sy ff Aub Crook! rborn, tes. Bell: | Sa’ ISsIO 1010 ot lovear Us r Aple at M-15 = $40 OLF | m:/tr ASTIC ze. R ¥2 or | 0 roller 289 _ 80 8 aters ers AL. EF CANA! urn 3 and Roche ell- past Ni N A ioneer | ¢ ed C 7 oO 5. 50 5 . OPI OR 3 _SEWI hela 36 an al “OOR SHOP j1 eters $55: 0 Sens, Jer call nes a vereols. [= ear ees UCTIO | CALIF ars a ‘2 pen Ni 71 Cr 9702 NG M Surp! De AEE Eopoe 53c Bue agina R SHC n $300 CABIN y it ta) is nd’ sup PARA pent || clo ee rY_ 215 NEV ay OR N as t S Pac ites BR a lWhite Pal mingled off LPS © St YP _ table oan mpeo _erv 2 Biles Cr ZEETS | 6 aed Gut Sara 21 ERY Sprnt QNTA ‘ to li ean FG 19 - -Beautit BEDE OOM: * Rte rey peugeot [Oven oto 8 ates Pe eit ee Seu Bird ewie For Sa ae SALE want tai on A BUYER ; gin nee fait Neaainbed "Tiaae full ul dre 5 arold’ 5 3 9 J es O RDW ll IN. AK & M: ——— FE ch- = c use. ales daily car ance FE HW ik ana Outi “Sales Trad: 095. uses dresser old’s 149 ee R ¥1 an ke REINT C Ry) aes a MAS PU 4-6510 or Sale 4 furn ally corae ene JUNKE | 46896 ¥: e ay he . ee rs d Lare s Pai $1 98 —_ 217 OR 46 rORCE NK cake te Ge UPPII e Hot H ‘sures Et paid mak EDO! e pe es ioe 4 a- ALLLOR Room, cheat mee inp een tainG a nn STEA = or S| 6ocxs ty Grecses | IES | ouset .| BAGLE peer OmsuaeD nd ea Hiv ue, reed for quick LL, 10g) udoir | ost rj to HROO Sagin & Li “2 ve we) AY M * SOLER: Joan h a | €ock papers Ashes els athe oS | trailers FE 3LEY odel. D x“ PLYM st Gal forsale! ADIO ONI R su lam uF) town ks ¥ FIX aw St _Ino O | pe a 1LERS nCRETE ie ER _FE gio mee F, 8 “OO rs 78 or : 5-0219 AUT Top all MI OUTH ciGaie Pear AY $ » PAY ree ben nets BU He Parke” 2 wir Le_R4. ata SPANI eM 7.0008, F aah vaeTOEn OPA ee Y ico oes RA ONG a le roux 2 ELE Se SPREE ne Eee ed R Eg MNCL ou Se! Ae @ or son's B EKL jardware elec ura ounce MEISTE Si ( ion 7 8. eres cnt Remote | PAY TOR pa BAGLEY | Ol overd UTH C ae : : re) : -° SoS PA ennel TES im DO Y 8 erari CONVE woe ank ve galvarize sgl at _And st al eS Alumi IRM Ss = r 4-4970 Bo pe ance 5. 25811, Ta ; rts LS 195 ce erts VER ao Tak Fu tee he trical eupol san = al doa SASH _ “GReenleal 811 | l eS car F 1 PI ae at ae TIBI FRA ive Go eA rnit H conn 1 eunol heat d - ASHI — Del eenl e Rd Pr T . ‘OR Mo ee ; Ba DE id se ure EIGH ck lies ee ny ombinatio SBE: - eat +4979 rice ad tra UTH 6-4857, neater tric. GAB Bell G FE st F TS 8 Bro ipe a soi} or nation A -RMAN _ 979 s sl eS : ins2. naport CLI boetdl w RB RANC ee pein BLOW E4543 UPPL see pee Oe FE evepaneed pp akcie PIN eee tt ashe ‘PLYM ation TmCOURE ‘Huron M IES tam LOW Y, ai E 4-6( pr owe Cal! giste SCH _ aile d oupe OUT FE DUP ‘uron unro POR ps| W ERS 2685 nt SN ry I89 ice! Wal red ER P - rs N on. | _cond Red HS) 2-207 E, $30 — Ele ELE Ith ata Per ow am DACH led I 9 we UPPI nv . Mt used | 1 ition io mw ia Ghana Hel ontro DF! ee 0 to PL n_to 9 | SARS ae ees ok ES ven Ist 80: S O PON ret ea AER we Sih AS STOVE. 415 1060 ox coptrain. In ‘good condition, mays te Le — “gn got, ite BRIOGS ATA “enous ee a Lae aaa out down 3.N. Main, R " rome's oom er FE ee Sood pace 5 Ww ~—- 1c. __ ond! : mb ale re rokee ie 8 | JISH ame | . Oc ) S P : ; $0 fi, $1 ze — RADEIN heater 13 1g Cees ————— (OURS mee RMEISTE oe Talbott. ener | nmr oi RINGER SPA con [OM Se ull ye OUT oF ee miwrae right Peoria rc van I CAB mun oeeoncae ow BUT. E B GER eens NIE pick bu ST 1) exc +b — MAN” is y L1 Be ¥ cl ATE 1 O 1 (SE ellen R aa @ uph. YEPT. CABINETS ee foo) dolla R Ss” Ps fum {1 AN SHEP! year e the Tee pele BUY [7s LDS-C ot T B + cond rote vani Sink a ter 6 D 2Y A UR Go paint mM yr. old HEPHERD. ¥ : RE- arele: new _ 193 ars f YER CASG LDS-CA del. LACK tion. L toon nae fi io Ae apa SINKS FR : RRO LTONE pee es Sel td Also ber HAM st te aoe erels ky! 66 8 8 8 aid Luckee 3 WI ASS ADIT del. side = ering de 1 uble bull FROM S TO a VICE are, ood Spre: r| meres asonab FEMALE. u “qr unee Stewa aD sagina ucky “49 to Lt SSat ORG eA Tele toerek PON aaclaln bee am Tho eer? OM 880 63 j -x8 sh cE Is | m4 plu rubber ad 8 ts BA le. M ALE ata 8 nd H rts. HE naw St, Auto "55 RC : be $100 26.000 rT 7 ep 1b des ps . mpson. ks f in fi $50 4x8 eet ERVE es oT mbi: ba atin t Shop LE A & “a irs bode al olly Gen i} y St. FE €a ILAR nee ext A 2 DR apiece’ ubk bed 96 08.7 abet ae mids rock C VE YOU | 2 iiines ng. electric and P 7p. 60.8 Att FA 3e37.| & Reuan ooe so. the Eee) oe 1IGH I 11006 : ARD Lk Mend oe Behone R. Teble top ving rr +. Es uO A Otel he sheet © aoe oe of ing. electrical sup i ket, R_ OF 1 ._ Astor CH. AL gee tt to rt coacl eters if hich DO JN | Meroe Coun. eee sie Hee ca ie ng rm 95 _rry. A| x6 Ww P Pi eet as | TOT Ph ‘um b. 8. do sup-| s. Fligh S_ Astor TE alt ank belie ach, ¥ ers. to ie them. grade LL A CAR . FE se Thos 592 car as to gas _ guite. | -| In4 fir » ipe 178 | LET. er. 105 Ora) and’ P it ca DING PARA: er rates va it ou h The ou Driv used ad R s Fi 5-918 m WN Oak! in On ree tengo $39.95 2x4 R- P ats $9255 ble PR 22 Oak! nd OOT: ges. Fi PARA ri parts al ow ins ave to pay s the exten | 4160 ROM 1956 4 ask ye and k * ne $29 Sr 4RoL Floo ‘er M 53 ne revers EE = and | | MTNIA LE P E 5- RA- an bott! and a insuran you well extra We nobles w W $59.00 96 PONTI for T Dairy. Ave a Ww washe 29.9 2 4 std A corn e. i$ 99 u ver used tri ANDING Y TURE i i P O led ccesso: ce. T “HL Il. 4540 ‘niles | 1940 ( b alton. | TO or acc om F $025. a G Dou y @ ar A E xf . Mee. Michi: «Vv ey | ee! seats . a bd $125 195 mere Pee ayt eae MANS robe a Os ce eins ft oo ee $20 vpe pou.) *" priv cpeed Et i — Mile ord . Michi- ANW xie CHEVIE. lock ra phys re. Pt ALIN arian, rae % Ta 2x8 std Genres fir, Ms moresurees “A "oR ‘base =| pao ie ees South rail UP “or WEL vm: east of | Dow RTIAC eis aa RCA ge D bia Deuslas be ne a ie USE free RT are Male Christ RD of Lak er Sal cs TO $50. 3-155 a ok GOO pow Most 870 A VE ey PE « CH OO 4x8x$ nket fi as tig. Pes M 99 00 SED FU of ch ICLE 43723. coal tem mas st 2 ake Ori es ats) PE FOR FFREY D co! cl er ste all 4 De 86 ne WAL SOLE 1122) Be OSE * rs see tir insl Per mf 99 00 gas bu RNAC harge -§ R hee KEN le. in | —— ft h nal ron PRIV pontine ——_ Us nD) ean. § An acces NOH RIES $29 try L ake Ply 1t $ sto me Es. OR E. P RE a Rd. for M24 ATE & 88 == A ED 153 PO 1925 and sori SE. TON + | nmr all Sunk OM 1x8 k fir score 8 9900} _e ves rs, b OIL, 3-8762 ARA pub Mt 1934 a Oe 4, ft . | fe PA 4 CHE CHE A 8-3011 CARS NT OR hae, : : Wi low BU 62 KEE He & tle | CHAMP e . long rie RTY ys o AP on it nonce 1a eq TIAC 4-2 ake plus nen nN" TV Frcnaaten a el full 1x8 Lometh ri Nets. 445 ster, O| avne H ers, RNE jes 1 Ts. 8911 j $13 AMPION it here! PRIC man 8 WIL: rev c ke MM ulty 2 eae Ve A cor vosire : . elin: ra up v gua Soll aneline Ine per ce $ 5.95 WREC IL 2-0: eati stoke RS, Pal 1304 M OPAL | oR fo ON 96 FT 1 La r olid L PA es ‘ash. M 478 ft EVE . Take DOOR Ty s KI meget nld i Ts a aHARREG tc INES. C jaoR re 36 _ HE I car. Ys bet El includ RY Pr) ove oa 1 RCTRIC HERG m1 BERRY f Esti us rantecd | Com pipe W vin Mo. $ 298 teria. NO 0. R dll _F Lraite eas CAI aE: O15 quity FT TR __ REST FE 8. 100 ween rose 7-4 ng ® THING “Po r pa $300 FOR Cc -2257| 3 Seer stex! on] + five. seer M ties *| Go. tect HOUS: oie | se a ccaNann F VAR: ET Pe Rone = Papi 195@ CHEV “pent be ales ta FE NTIA yments. FE heb wi ectrie RANGE "| 3EEP a SALE on! 3 PC hum. M Ueeee , Ine. r sal Es PA Since. ANAR __ PE 4-6960 1936 a N 86-1371 R. BILD HEN C sf can ps ‘oily, M x E NTIAC. Gan ts. FE ot guarters. Ood ig ee calor doors home 00 |-_ feat 6 31045 Bs ALL M ARAKERT 1927. 584 Oat GAGES eal heres EW GE or 6 wT SPEN oat |> oe DEI ten | We Po! afte DC OM = 5-704 PORK. } oe yored bath rom $ 2095 eee Orchard Lei Wrecking ables vonis pyre one Grg.| ° le ee rone NERA 62_ Oak! USE =NCE new, $325. ELUXE, Chie NiaG wove. ‘ONDITIO ACHI t vk HALF A jek cast 4 ath s 29.95 WIN +3043 Lak e wis nae Pour 4 Only ft Oakient A pitence Pode) ner TS akland A D CA FE +DR., et c cu Loe ON. ectric. rors Ma: AND. H ron tu et. all $ 14.95 KLER e Rd Rd. 1 4th til 9 p coaes STRAIN. ou wil m paris s Mak ngle R Se nae RS +0240, rea sto! : 5 rket D> AR b fitt Ww . GR _4th_ St & AIN the 1 b sop e and eX rake an, M nt meee FE, oF "BONDE _ pow scp! Suge orn rth = ae o1 Supeties. joe ne convinced rm eom: wert oe Motor Pee 4709 CUSTO RD we Pe tacts mee hoon oe Cash 2 sree ifiterior AS House 'p Ages Piinrer te r 8 pacvagiche fe ees ir ee a one Save dolla il aie melt is | WTD. ie ue Hw yon late t Sales M 8CYLI Digan alls Pager BA SRE Co ree nd car #544 oors, 4% $ SITER RIVE BUILE ____Do It Yo I 72 oO PO Mel CAN. railer ollars t. single | fore iron, UN aie Rar TUD LINDE PC ike mizine ar RGAIN 2. rry "Pontiac | pert | 500 ON AL AND “Sat PN ck | Jac t Yourse : M ODER ae Lt at ees fishing e bedroom. TOP ae = amen & 3-180 OR = ok ONTIAC < RCHIEF. Al AL ‘in * N? Lot CHR rin Ave. PE MAKE MATERIAL UP TO | 3 KEON'S RE self MINIATURE, PUPP Ae $80 down. ‘Or and bunti “| and Inte mod Toa cua es $5 36 Ww. Gren G00 ec . e Want Adal “CHRISTSAS TOO | BURMEI: cP sae gun roa eafetn ai] ange aes PIES | ing NE alia 2 “oH Eh,» ae ee an : a - a frases eins [PMEN ; ee iat ariet NDARD IE iE es, 210 anted ARS ARS ar Sean Aad ics NS OOLS RMEIST prumoine wiring a a eaters Be ls | ene 2A ODERAREI a F : © wi 40. - 25 ZENRELE stul| mod { ubu \/ ht Ric E br boi CBRE eS Northern L STER | 2 ‘thee "a, tee Own —rnagttn atic 2 ae ray one rele besa ee rucks #9 JE * ee J Ove "eoniton } ‘Rd Cc. 9197 um 5-47 y. 156 ontce: Tr. eroc ‘om: | ‘ETS-PET -8911 . to rea ce nish ER RO an. AKE ondition ; lac Cooley ber G rc 12, Fri. West Im B ‘k ov 239 v NCEY PET: Po rms dy to lots. ee “ WA R __Maz R CH 7) FE Telegr e Laks 0. loge thru Mon’ ahaer dj corhe 8 P SUPP TRA ntiag and on! mov ‘in- FE A NT HESTER urek “Mu cle AMP’ 20333 Detroit Ra eve Serpr prety re: | PARA is, Rd ET 8 PLIES Huet e a -_ PAR e into. > °3-9862 ED | 7 (alee Bal MEIONIS 8 \ af ‘ene E ry Thursdays FE) A KEETS. | 1) mule” NORTE saeate att For ORE Ne ieee WHY DRIV pelo Jf < | _ Me 3.3147 | we FO way Unss* 3M FE 5- yy aeastt soli ta Gl eae Sa 5 TH. LER Y Dk unis , | ) ria pat pes ; eae _ nt “SP s ri sais. | eet pansies Ovals Pulte sss YRS. A USED CAl EA \ race rate: hand lar ys ea AM SPE rion. 13 Pi ‘CH Ory 90 ee . + ad AR? : 3 e “RO FE | ERI “C WF arkhurs: EV Porn 83 very. clear ad ? | _ spore tat Fusl pred caer ct archery Roe Or NEW SAVE 41 AL es urske PEE 20468 at 3 CHEYROLET, "PE. 48 NEW V- i rd Lake A i Paint orp agin Dwight Chechtent (pDESK. Ages to) 2 BED “Heater. Sig ile ato aier 6 eee paren BEL A mot, _ FULLY 8 DODG og i vate EXINGESE PU sn condition ig tte force £3 en Peg ora it SRO tow trans. Low nts FEMMEQUIPEE eS v) oF colored. ; CON ND won OM | Saal) cow : 5. G ® MOTO! -} it r . oe Lo NEANGE, TOT E83 sncniaewa be tan : at e. pregame auto D f able Chris mal FT. RK ly own TO: : cl ts, whi matic i few see FOR i$ . ON ORK TA- pa: N arkston etm signals a or pervice. 1 5 Cennatt wi ve L LY si00 Sa Bethe bo mn oe erkaen BA ne) wake, int trans ' PE 53h etl ae eS mee baer 1952 oon ee ‘we month- moet . | Byzoe $2,3 Bseaes | ee) Sa CLEAR this Se f. fas ei ran DON’ Zo preter 83.88 : ie s ‘ es a? at Sats. .| oF € Hheeler, ‘Traiim tr eS WISH RIEMEN Dy pet rod FE 38786. 316 or wahout nate 4s| thr { Mak FOR D NSCH “ears. . m trad Job. $5, ough Cl ake iod N ; } 4 "estate 5 th sell, 2 aera easily 232 eee t ie evenings diat F nt, ds. To 1088 | aginaw Dealer baie : E281 181. BwEP, hire Rate. FE 2 9131 vey ae y a, Heater Fore-Oaaaua, Por > 4 / ; 4 \ ‘ - f-4 paint, V a," j ' iH ery ‘ i : OWARD | clean ‘fr NC. ; 4 v . a, * a THE PONTIAC PRESS. SATURDAY, DECEMBER 24, 1955 _ --Today’s Radio Programs - - WIR, (100) KLW, (000) WW, (900) WCAR, (1190) WXYZ, (1770) WPON, (1es0) _ WIBE, (1000) Programe farsiched by stations listed In this coleman are subject te change without notice. in N ew Year S pectacular. TONIGHT == ~ 6:00 WIR, Joseph Hainline 1 seoWghe We Patter Pastor | STOR, Hows. Musie WEAR, Mews Aco Channel 2—W/BK-TV Channel 4—WWJ-TV Channel 7—WXYZ-TV Channel 9—CKLW-TV . Ww4, Lite Oin WXYZ, News, Piisrimage wav “Breet ten coi wa" Bruce Mager nM) TONIGHT’S TV HIGHLIGHTS |7:00—(2) Cross Current. (4) Badge; MONDAY'S TV HIGHLIGHTS |... etal =e pence play a ie di id , , \e a re w= A isters WB. meee fear MeLeod wane Gnek Music WCAR, Rnyinin Round caw. reve Cees ner “Deller ram te ciel pig, rag ee me ee ar00-- (7) (Amie Oakley’ Show (9), ;Gobel will make his color TV| on one oe tne shows won, Ne WJBK. News, y Shorr r . yoy violinist | oven Circle 9 Theater. , Plat Goes WPON. a ple arene A . tter peer . wan es Wo unre Wamu ng rhode runs away from the concert stage; the church and police are sent!g:35 (9) News. Pac LeGott. ‘debut on NBC's New Year's night Rudy Vallee will portray him- et am ow) ‘Bees Meee Be” |e Mae ("gir Be tae "| to vat Gen, Saran ak 19 fd Ole return olla) Weatherman SOHC, ying to New York te dan sora WwiBK. Parliament Hill CKLW, Elder CKLW, News, CRUW. Ted Mt (ae tion. (7) The Explorers. “The the priest that they won't be able g:39—(2)' Invitation Playhouse. (4) from Hollywood immediately a after) Sn, .. WPON, Sports ‘Slants Wean, "Christmas “atesin WAR, Temple, Ne oe Wonk ney enor verse | Spirit of Christmas.” Features, to return the statue by Christmas) News. (7) Trouble With Father. |his qwn New Year’s-Eve show. Aries hr inets and (ree [mens 1:00—WJR, Make Way WPON. News Platter Parlor | WPON, News, Part Mabel Beaton and her Marion-| and while they are talking a little ¢:45_(2) News. (4) S Par-| . ibersiof her “Home’ show staff are W2Y2, News. Ga 1 “WWI. Weekend’ Mune ww), Detrott nar Goat 00 WIR, im Vinal ettes. boy walks in the church with it.) ade. oe gt sens that acts minute af Aye ge Fert ale: Cee CREW. Pamily treet’? | WXYZ. wings of Healing WXYZ, Whispering Streets| ‘Ww News el . (2) You Asked for It. (9) The. , 'Georgie’s one eight-minute mono- mas, to film a Japanese New Cite, erkesae ain WEY2Z, Whispering § 6:15—(4) Candid Camera. 7:00—(2) Lassie. (4) Dr. Hudson's SAG cee toes 5 . ware wan Visitor. “The Buntli ay logue t 'Year's celebration, visits t J WJBK; Mews, Mickey shorr| CLM. Bethesda, Te WosK. sol fcc wre. fred = BPO PS uuntline Special.”| secret Journal. (7) Kukla, Fran 8¥e on the spectacular will cost isits to a Jap- 128 -WIR. Jr. Town Mesting| WHOM” Hintier Panett’ | WEOR WPGN Goce Cating| WOBK: Nowe Gentile Binge |p rating.” Rickey and|7#3—(2) Private Secretary. Susie! and Ollie. (9) The Falcon, *bout 375 miles of travel! oe eee WXYZ, As We We See It oe ee inleo Wane Art as getter 6:20—WIR. Voice. of Agriclt Fred play a joke on their wives| ‘8 invited to dinner and discovers 7 215—tT) News, John Daly. Peesiets: Teo enoee et WIBK. Mickey” “shor ae Woolworth, Hout CKLW: ‘News, Story Time | WHY2. Pred W Wolt and almost leave them without! ‘at there are strings attached. 1:30—(2) Robinhood. (4) Tony: Annette Funicetlo, IS-yearold = ABC is expanding Ted Mack's : ‘ , News, Stor: Fron " Roa j “4 , 47 : ‘ v0 . WPON: Record Room wine. Phas toed WIJBK: News Tom destee oe News. Binge. Gentile} any furniture. (4) It's a Great (4) ie reid Long d to Martin Show. vm Topper. (9)| ‘Mousketeer” on Walt Disney's Or iginal Amateur Hour to its origi- wae: Dickens caren WCAN, Noel, Kemae kine | WCAR. Mews Ace weon bine teins Life. “Hawaiian Holiday.” Earl Tucson.’ (7) Famous Film Fes-| Million Dollar Movie. | “Mickey Mouse Clum,” has been na) 60- length, starting N WWJ, Monito: PON. News, Record Room | WPON, News, Pontiac Party| | 4) yp ply Vina ‘ , tival. “The Red Shoes. (9) Dial 7:45—(4) News Caravi ve i a ade Bae Fee’ | tee pee |e Rae tree | ewe Seve is the lucky winner of a trip tol ‘The ster hoy See iiininseccs iaieainn| soca Sb GD | LA contd heboarmed WXY2, Oegood, her wolf} Hawaii for two. (7) Realm of the - (bs Ss Cd Ale (4) of fan malt—and os 2 result she a ee WPON, News. Record Room| CKLW, Woolworth Hout cx ef oe alt Day cELW. 3 swe Gentile, Binge Wild. 8:00—(2) Variety Hour. Ed’s| Cesar’s Hour. (7) TV Reader's is now being starred on a new = Lebanon now admits bees, for- ~ ae-WIR, Ch Christmas Carell. w. JBK. "Sinn Leod wean co coor WPON, News, Rise 'n' Shiuej7:99(2) Big Town. “Han dicapped Christmas Day is aimed at chil- Digest. ; TV series being filmed in Italy. merly banned from import, Bei- Wee. Bancing party | WPON gRecgrd Room i” | WRON Pontiac Party" (ne WIR, Mune at "Worker." Steve is inspired by| Tet in the audience. (4) Comedy #:30—(2) Talent Scouts. (7) Voice She will Introduce and narrate rut reports WiBK mackay ener WWJ, Monitor , MONDAY AFTERNOON WXYZ, Osgood, News, Wolf} the plight of a young worker Hour. [not Firestone: Se eee . PON, ‘Record Room WXYZ, Revival Hour 12:00-—WJR. Jack White CKLW, Terrence O'Dell 9:00—(2) TV Playhouse. Musical 9*60—(2) 1 Love Lucy. (4) The ture series. | Pickart News, Big Bands CKLW, Mutual of Omaha WJBK, News, Don McLeod WWJ. News by Croerburg WXYZ, News, THIRTY- SEVEN | Winter of children, and then finds that who loses his legs saving a group Play. (4) Alcoa Hour. Opera. (7) Medic. (7) Jumbo Theater. (9) WPON, : WWJ, Monitor WCAR, CKUW, News, Three Sons | :00—WJR, Jack White ; : /hous ; ‘ot Ste mene Dec WPON. News’ Record Room WJBK. ions Tom George | WWs. Bob Maxwell his job is no longer open. (4)| Chance of a Lifetime. (9) Mo- Po baippiat idiaseat Bride. (4)! Br patie qacelucuaee te 5 7 Choir re _ 8 WCAl ew WXYZ, gages Z - os :30— mber rae. ( z WJBK. News, Mickey Shorr| ‘ww seinten” Afternoon : CKLW, News, Toby Davia | Soldiers of Fortune. “Bite of tion Picture Academy. “Miracle Phyllis as a result of her acct- WPON, News, Zee, Orville WXYZ, Revival Hour WJBK, News, Gentile. Binge 9:30—WJR, Goodwill J'boree| CKLW, Mutual of Omah: WWJ, Paye Eliza WCAR, ines = Fie 7 , . Medical Horizons. (9) Denny dentally broken jaw, the Fontaine! WWJ, Grand Ole Opr WJBK. Mike Perrint | WXYZ, News rea WPON, look for a tribe which are im- 9:30—(2) Alfred Hitchcock. ‘The Veushan Show! ”' sisters are on an enforced vacation| WXYZ, National Juke Box | WCAR, Caravan of Music| CKLW, Bud Davies 8:30— WORE Music Hall mune to the bite of the ruby red) Cheny Vase.” Y lot aughan sho | CKLW, Walter Schuman WPON. Record Room WJBK, Tom George | WWJ, Bob Maxwell -_ eoeny - soung man Plots 19:e9—(2) Studio One. (7) Story. Because an infection sent Geri to WJBK, Mickey Shorr 5:00—WJR, News, Symphony | WCAR, Music in the Alr| WXYZ, Osgood, Wolf tick. (7) Douglas Fairbanks pre-| to steal a valuable vase from a . the hospital for nearly three weeks, WIR. News, Br WHYZ. Holda on eR Rend ete wae Heme Binge Gen ee te eee ae ere) OCEmsl Arasiew een) wae =f t. «7) Ellery 4nd now doctors say Geri (and per-| '19:00—WIR. News, B. Crosby Rin Tie Ta |) WWJ, Ross Mulholland WCAR, Co! Baptist Church. : aterfront. (7) Ellery : | WIZ. News, Top-T Wolm, News, Mike’ Perrin | WXYZ Magic | Kingdom Rise "a | eee Queen. force Bea and Margie, too) must CKEW, Lake Charles Choir) WCAR, Sign Off CKLW, It's My Living 9:00—WJIR, William Sheehan 7:30—(2) Beat the Clock. (4) The 10:00—(2) Appointment with Ad-) 49; (9) Sports Fil rest for at least another-month. WJBK: News, Mickey Shorr| .WPON. News, Serenade WJBK. News. Tom George) wwJ, Minute Parade Big Surprise. (7) Ozark Jubilee., vent oA :45—(9) Sports Film. WPON News ey Shorr) 5:40—WJR. Siday Bymphony| WCAR, News, Caravan | WXY%, Breakfast Club Zz ae -| venture. ouch of Christ-13;99—(2) News. (4) 11. o'Clock. 10:30—WJR, Bing with Bing heal Coe er - fetta | | caLW, Sewn, Tom Devs r Barn Party.” (9) Holiday) mas.” Old mansion being used| News. (7) Soupy’s On. (9) Na | Ford Theater has signed up Irene 4 Ca) to i. . ws, - a. * . iva < WEE Top of town | SALW. Sinetag ours” | Wey, Rou Muboland | WCAR Neve Mee carpet ey the Aray 1) Loretta Yoime | “tinned News [peggetgoons meornigegonare ie . ! “ . . ' CALW, Gut Ganctury | Won, Dinner Berend CRLW, Radie Cantor |o:30~ WIR, ‘Mn. Pee 8:00—(2) Stage Show. Emmett Show. (7) Hockey. _ H1:15—=(2) Miss Fair Weather. (4) ae WrON, das tna Ore || we Be WWJ. Minute Parade =| Kelly, King of Clowns. (4) Perry 10:30—(2) What's My Line. (4)| Little Show. (7) Armchair The-\£V¢ upcoming productions. 11:05 OW ote vt = SUNDAY EVENING WAR. News, caravan WXYZ, Breakfast Clud ey, Dein ie = <5 enow (0) Armchalr » penlore Guy LW, Da' Como Show. (7) Ozark Jubilee.| Confidential File. ater. (9) Billy O'Connor Show.’ WCAR, Rh WPO! CKLW, News, Bud Davies p _ Aa Rar ; ie oS oe and Sports orts wien, Mews, Showtime WIBK. News, Con Me WW, Mc ride. b bled away »& large et money /11:15—(2) Miss Fair Weather. (4) |!1:%5—(2 } Nightwatch Theater. at J, St. Paul's Cathedral! ¢:3¢—WJR, Gunsmoke WHOM, Mews, Nelsen Edy | Citar’ Nows Bemernces plans to murder his wife Movie of the Week. (9) Crown | 11:30—(4) Tonight. t CRLW, Prince, a fee wave, sarees Co: ee —_ WJBK. News, Tom George |8:30—(2) The Honeymooners. Alice; Theater. SUESDAY MOANENG . venin, mes ww. ps i WIBK. Mickey Shorr KLW. Bob Considine WXYZ. News Winter” WCAR, meee Pentinc Panty; S008 & neighbors Christmas gift) 11-29-(2) Les Paul & Mary Ford. 825 W. HURON WPO 12:00—WJR, Midnight Mass WWJ, Musie "Till Dawn | €:00—WJR, News, Autry WWJ, Meet the Press WXYZ, Drew Pearson CKLW, Episcopal Service WPON, Idle Time Serenade 7:00-—-WJR, News, Bergen WPON, New a: 30_WJR, Time for Se peees 3: ae WIR. 2nd. wae BK. Don McLeod Nunn Mrs. Burton Mulholland 1e:30—WJR, Arthur Godfrey WWJ, Detroit Weekd ay n of Music) wxYZ, Whispering Streets the Ruby Red.” Tim and Toubo (9) Inner Sanctum. ‘‘Hour of Darkness.” Man who has gam- and thinks it pretty sad. Ralpl has gotten her the same thing of the Bells.”’ 11:00—(2) Sunday News Finals. (9) National News. | B8s88—(2) Nightwatch Theater. Robert Montgomery Presents. (7) lout | /11:20—(2) Les Paul and Mary Ford. 6 50—(2) Les Paul & Mary Ford. | | (4) Today’s Farm Report. -SEE COLOR TV We bow our heads WCAR, Carava ware Letter r oah WWJ, Monitor Apbete i iste Warren CKLW. Mary Morgan (7) Ozark Jubilee. (3) Silent | MONDAY MORNING '6:55—(2) Meditations | WJBK’ News. Mickey Bhorr| WXYZ. Showtime Revue weWi (Neus |uy! ions Re ee erie geneai |) Night. 6:50—(2) Les Paul & Mary Ford. 7:00—(4) Today. (2) Morning | os | CKLW, Wines of Hesting y WCAR, Walled Lk. se | j f WPON, News, House Party) wJBK'’ News. Perrini wxvs. 5a MeKenaie, WPON, rom. Coes Calling g:45—(9) T.B.A. | (4) Todays’ Farm Report. Show in prayer tor peace SUNDAY MORNING (a.beSWaR Edgar Bergen wax Bown Des necteed Mites" Detra Weegsay 9:00—(4) eg in Tevlent Color. bed a a ; [7:55—(2) News. Se wicusanec nae WXYZ, Valent WPON. News, Club 1460 SKLW, 5 Star. News | A star-filled cast for a repeat)?:00—(4) Today. (2) Morning 8:00—(2) Cartoon Classroom. BULLETIN © wae —, tia Wour cKLW. Radio Bible Class 3:30—-WJR, Helen Trent WIBK: News, Tom C George | production of ‘‘Babes in Toy-| Show. |8:30—(2) Captain Kangaroo. (7), and love among ¢:30—WIR, Farm Review | Won, Gos Baptist G WEYR, Nova MeKensio | WAN Neve ‘re land,” a nursery-tale operetta|7:65—(2) News. Wixie Wonderland | WWJ. Monitor WPON, Gen. Baptist Church s WPON. News, : 7) | 8: : | : WJBK, Album Time 8:00—WJR, Our Miss Brooks | CXLW. Bud Davies Comers ab "haxe “Op ina with music by Victor Herbert. (7) | 8:00—(2) Cartoon Classroom. 9:00—(4) Romper Room Get Your Reservations mankind on earth. arom, News, Music Ws, Mentor ee eee WCAR, News, Caravan WXYZ, News, Winter Lawrence Welk Show. (9) On/8:30—(2) Captain Kangaroo. (7) Theater now for our Poon tails tal ae CKLW. Christian Science” den—Wam, House Pasty CKLW. Queen for Day -| Camera. “Our Lady’s Tumbler.”’) Wixie Wonderland. \9:25—(2)—TV News. CRW. "Wildwood Church WiBK bepsckay Ltd WWJ, Pre WCAR, Music in the Air |9:30—(2) It's Always Jan. (9) 9:00—(4) Romper Room. '9:30—(2)—Love Story. (7) — Re-. NEW YEAR'S EVE DANCE wren, Genulerios 8:30—WJR. Two for Money cae "watirick. = WPON, Pontiac Pa-ty Hockey. 9:25—(2) TV News | quest Theater. : MEMBERS of 120 Wm, Larmen's Hour) Wxvz, Mocke; WJBK, News, Don McLeod) qygspa¥ AFTERNOON /10:60—(2) Gunsmoke. Chester tries |9: 30—(2) Love Story. (7) Request 9:55—(4) Faye Elizabeth A Merry Christmas To} WXYZ, Muste. for Sunday! CKLW. The Quiet Hour Weter Gree chek leas). 2 e UE. cack Wane to teach his anti-social brother a! Theat i | PONTIAC ASSOCIATION MLW. WPON, News, Club 1460 WWJ, News by Cederberg er. be ov—(2) Garry Moore Show. (4) All M Good Will} CKLW, Tabernacle Waoe Answets Quaréntesd | 4:se—wsl, House Party WXYZ, News, Winter lesson. (7) Jumbo Theater. “Doc-|9:55—(4) Faye Elizabeth ae eee oo : —— Preteens Hour Pe a rp ad hl a ¢| WW. Pro Football CKLW. News, Three Suns . fall.” f a 2 Ding Dong School. of INSURANCE . Armenian Hour x Wallabeainee e Wo WXYZ, News, McKenzie WJBK. News, Tom George | ‘Ors Downfall. 10:00—(4) Ding Dong School. (2), (10:30—(2) Arthur Godfrey. (4) — *wwo. Monitor Sheehan WXYZ, Hockey Sone’ | eogesleat oe WCAR. News 10:30—(2) Man Behind the Badge.| Garry Moore Show. | Ernie Kovacs Show. AGENTS CRLW: Your Worshio Bour| WIBK, Soba Perrint WCAR, Caravan of Music [joss Wak Time for Music (4) Your Hit Parade. 10:30—(2) Arthur Godfrey. (4) | 19:55—(7) News HUSBANDS WJBK, News, Album Time |WPON, Liberty Bamist see lWIK. “Willies Sheehan| WWJ. Paye Elisabeth -/11:00—(2) News Finals. (4) llth Kouacs Show. 11:00—(4) Home. (7) Story Studio Frank A. Anderson Agency wean. xour Corel a Lipa ieee! e Teags Wolf | “ww ball = rt Sho po pees Hour News. (7) Hollywood Pre-|10:55—(7) News. 11:30—(2) Strike It Ae Give Your Wife o Break... ; m) ‘ s © 2 “ ” . : G ‘ tin-Nervell 8:30—WIR. Rentro Valley WXYZ, Hockey wave pb rag beatae WIE. Tom Geetye miere. “Black Beauty.” Story of/11:00—(7) Story Studio. (4) Home. | 11:55—(7) News Ace. don't make her be a stay-at- Austin-N Agency WXYZ, Light and Lite WBK M.§.U. Woan Bews, Don McLeod | wpON, Luncheon Music a beautiful horse and the young] 11:30—(2) Strike It Rich. ) home just because she can't Baker & Maneen CKLW. Pontiac Church WPON, Concert Hell WhOW. Seas.” Serenade IR, Life girl who watches over him. (9)|11:55—(7) News Ace. TUESDAY AFTERNOON drive . . . bring her to the a WJBK. Gilead Baptist Ch. 10:00—WJR. News, Nation | 5:39 wm, Music Hall Na peepee National News : Br a WEAR, Back te Ged. | WATE tock WW. Pro Football Calw: weMy tring |s1:49 ie MONDAY AFTERNOON —'#:60—(2) Valliant Lady. (4) Ten-| SAFE WAY WPON, St. John's Lutheran! z, Hockey WXYZ, News, McKenzie CKL 8 ng 11:10—(9) Movie Date s essee Erni (7) 12 O'Clock’ Crawford-Dawe-Grove Agency 9:00—WJR. William Sheehan| CKLW, Hour of Decision CKLW. Eddie Chase WJBK, Newsy Tom Geor me e. - DRIVING SCHOOL WWJ, Crossroads Church =| WJBK. News Wayne Univ. | wJBK) Don McLeod Weonl lawn Piacur Parter| 11:15—(2) Miss Fair Weather. (4 aa: :00—(2) Valiant Lady. (4) Ten-| Comics. Daniels Agency eas ec caereeenh \10:30—WJR. Many Lande WRON, Dinner Serenade || 59 “WJ. Dr. ialons My Haven Home Theater. | messee Ernie. (7) 12 O'clock 12:15—(2) Love of Life PHONE: = sans WJBK, News, interiude WWJ. btiernal ul WXYZ, Revival Time MONDAY NIG WWJ. Ross Mulholland aT ob Hainiine wxvz. News, Winter /11:20—(2) Les Paul & Mary Ford. | | Comics. j}12:25—(9) Prayer, Sign On. | Wm. W. Donaldson Agency WCAR, News, Spi 6-00-WJR, J :25—(2) Ni i PT; 4 - WPON, St. John's Lutheran WiBK. Sie orca WWJ. Pro Footba eatchel dopey icone! at Nias eich Theater j12:18—(2) Love of Life. 12:30—(4) Feather Your Nest. (7) | Gilbrid@ Maflban Agency Caw unten S| WPON, Sam Junes WXYZ. Wattrick. McKenzie; WAR, News. Caravan SUNDAY MORNING lie: 25—(9) Prayer, Sign On. Beulah. (2) Search for Tomor-; oO 0 r) } | ry ohare i WXYZ, Voice of Prophesy iww a Snceben | WJBK. News, Don McLeod Nptae og Oped burton 8:10—(2) Meditations. 12:30—(2) Search for Tomorrow. row. (9) Magic of Music | CKLW, Commonwealth | WXYZ, News, Mood petits Reynold WW4, Ross Mulholland \8:15—(2) Christophers. (4) Feather Your Nest. (7) Beu- 12:45—(2) Guiding Light Maynard Johnson . ree Se ee eres eee WWJ. News by Lewis | | WXYZ, News Winter lah. (9) Fi d Feathe /1:00—(2) Ladies Day. (4) Color- | WCAR, Sptrorama | WJBK. News, Perrint WXYZ. Stlll@are CKLW, News, Bud Davies (8:45—(2) Facts Forum. an, (3 ur and Feather. ; ‘ 7 . Lazelle Agency, Inc WPOM, (Biverciest Baptist) || WEON Meee Specs CKLW. Rddie Che WJBK, News, Don McLeod |g:59_(4) News 12:45—(2) Guilding Light. (9) Au-) land. (7) Lunchtime Drama. (9) § _— Tew Uncitecal meeciralon Ue Wan Starhiens ren WJBK. Don MeLeod Woon, News: Nelson Eddy |9:00—(4) Church at the Crossroads.| brey and Gus Mary Morgan Show. W. A. Pollock yWJ. National Radio Pulp: WPON. Sports Slants widely ss | =] ao WXYZ, News, Israel WXYZ, News. Beyond Stars : | 2:30-WJR, Nora Drake 5 /1:00—(2) Ladies Day db Color. 1:15—(4) Fun to Reduce ow : CKLW Mt. Zion Church 7:00—WJR, Guest House Weekd: 9:15—(2) Court of Health. z tod thee din ; } ’. Strait WIRK: Reverticescriee | WIBR' UD, Rounatate | WWE) Taree star Betre | NZ, Pura Wasteey |g:5q 12) This Is the Life. (4) land. (7) Lunchtime Drama. (9) 1:30—(4) Good Cooking. (9) News. Ea AUTHORIZED maeiniiae a ee | EUS CKLW. Fulton vewis Jr. | CMLW. Bud Davies Frontiers of Faith. | A Christmas Story. | Shoppers Show Maniz TV Thatcher-Patterson-Wernet 10:36—WJR, Chapel Hour MONDAY MORNING habla nese Mickey tt WCAR, Caravan of Music |19:69—(2) Detroit Pulpit. (4) The! !: 15—(4) Fun to Reduce. 1:35—(2)—Girl Talk. (4) ‘Fran Wilkinson Agency WWJ, Boy Scout Report 6-00—WJR, Jim Vinall "PON. WPON, Club 1460 '1:30—(2) Amy Vanderbilt. (4) H Harris. Rebtel wl odd bapedl bet Pees le WPON. News, Spanish Hour ,' Joyful Hour. (7) Christian my vanderout jour Harri SERVICE XYZ, ob Maxweil 7:30—WJR. Guest House 3:00 -WJR, Wendy Warren - 2 Vv ian CKLW, Voice of Prophecy | WXYZ, Fred Wolf WWJ. Morgan Beatty WWJ. Detroit Weekday Science. | of Shows. (9) News, Shoppers 2:00—(2) Robert Q. Lewis. (4) 3 J. L. Van Wagoner Agency, ws Musical Memories CKLW, Rooster Civ WXYZ, Day's Even WXYZ, Ed McKenzie | Show Hour of Shows. (7) Stars on) g WCAR, Bible Class WIBK News, Gentile, Binge CELW Gelitel’ bociter CKLW, Bud Davies |10325—(9) Prayer, Sign On. | h CALL Pontiac A iati f WPON. Pirst Matnediet WPON, Cowboy Hank WJBK. Mickey Shorr WJBK, News, Don McLeod (19, 39 (9) Cartoon for Kids. (7) ':35—(2 2) Ladies Day. Seven. | ‘ontiac ssociation 0 11:00—WIR, News, Big | €:30—WJR, Voice of Agriclt.| WON. Spanish Hour WCAR, News, Caravan 1:35—(2) Girl Talk. $3012) Linkletter 3 y TOBA DERAL J Ww. St Paul's Cathedral, WWJ. Bob Maxwell 8:00_WJR. Bing Crosby WPON, News. Club 1460 Action Theater. (9) Holiday with 35— vir] Ta 2:30—(2) Linkletter Houseparty Insurance Agents WXYZ, Music for Sunday WXYZ, Pred Wolf WWJ. Henry J. Pavior 3:30—WJR, Helen Trent S 2:00—(2) Robert Q. Lewis. (7) 2:55—(4) Shopper's Weather. - CKLW, Pontiac Church CKLW. Guy Nunn WXYZ, Show World WWJ, Hotel tor Pets tars. | > , on WJBK. News, McLeod w wie Mews, Binge. Gentile CKLW. Top Secret Piles = Bes eu wees 10:43—(2) Sausage Sinema. Stars on Seven. 3:00—(2) The Big Payoff. (4) NBC WCA N se “D' , 7 hy ries 9 , : r , i WPON, Central Methodist | 1:60—WJR, Jim vinall” WOR Mech. Wencs Reun| WIE, Dea Me 't1:@0—12) Porky Pig—affy Duck. 2230-2) Linkletter Houseparty. Matinee Theater. (7) Heartthrob AN OLD FASHION WISH . 11 8 WIR, Tabernacle WW, Bob Maxwell woit | 8:30—WJR. Talent Scouts | WCAR. Coreven of Music | (4) Adventure Ho. (9).A Christ- 3100-12) The Big Payoff. (4) The; Theater. line fond WWJ, St. P Cath ‘ . WPON, g. ae News Music | CREW. News Toby David, | Wrz, “Pirestone ‘srwa, migod so Mappinses_ | s°sa'-9, the Littlest Angel ces me On cases) Recs po owe ence ne ies netiosa! Chare: CKLW, John Steele . |11:30—(9) The Littlest Angel. . : f holid that f JBK! Don McLeod WPON, News, Rise, Bhine WXYZ, Wattrick nle - x A : | or a holiday season tha ween Radio Temple 9:30—WJR, Music Hail wien, ces | ewe! CKLW. Eddie 3:30—(2) Bob Crosby Show. (4) | 4:00—(7) Captain Flint. (9) Jus- a bright 'n cheerful WPON, Central Methodist | WWJ, Bob Maxwell 9:00—WJR, Jack Carson WJBK, News, Don McLeod SUNDAY AFTERNOON Pre-Game Review. tice Colt. (4) A Date With Life. | is bright nm cheertul— semeat asraaneew ware. Cored Mere | Ww, Telephone Hour woe Eree cues seas wes Crabt $:45—(4) Football. (2) Brighter Day. 12:06—WJR, William Sheehan Fo) ene Risen. shine CRLW. pob end. Ray may on e Widder B pie it ee aa his Pets on =e) News 4:15—(2) Secret Storm. (4) First] 1 H . ews, You jer Brown n l ‘ - . | RAD 0 d TV wareeee oy 9:00 —WIR Jéck White Wee, He Rews, Mickey Shorr ware. ay hans Gusbey G laa (9) Captain Z-ro 4:00—(2) Brighter Day. (7) Cap- re. : | BLAKE an CKLW. Labor N : ose lwone Pelee Andy | CKL , "| tain Flint..(9) Justice Colt. 4:30—(4) World of Mr. Swee ts WIBK. News, Don McLeod! WA*e Osgood News, Wolf | "Ww. Band of America W4JBK, Don McLeod” 12:15—(4) A Carolling We Will Go. |,, ney 3149 W. Heren FE 4-579! CKLW, News, Toby WXYZ, Off WCAR, Caravan of Music 4:15—(2) Secret Storm. (7) Auntie Dee's Rascals. (2), WON, News WIRE, Wows, Binge, Conti | CELW Bob ead Rez WPON, Club 1460 12:25—(4) Mr. Twinky 4:20—(7) Rickey the Cl "On Y ieee ee Gag Geastien WCAR, B ews WJBK, Mickey Shorr 5:00—WJR, William Sheehan **' . : / 4: u ickey own. our Account. . eee ae ae ae WWJ, Weekend Music | se WOR, Mastic Hal WPON, Zee and Orville WHY Warten Mekensie 12:30—(2) Wild Bill Hickok. (7),4:30—(2) On Your Account. (7). 4:45—(4) Modern Romances Oakland County Electronic Association Ae ete Pramas |! bhi deg el, a accep Eee CKLW, Eddie Cha Faith for Today. (9) Watch the’ Auntie Dee's Rascals. 5:00—(7)- Mickey Mouse Clubs. (4) WJBK. Tom George cRLW: Toby David” ° ot AE eat E Moreen WiBK. aon on Don McLeod Birdie. 5:00—(2) The Early Show. (7) Pinky Lee Show. (2) The Early’ s é | rc r a 7 w Y. News a ren o> F ~ : WON ‘Luncheon Music WAR, Coffee With Clem’ | WJBK, News. Mickey. Shorr pies Newe, ‘Berenade 1;00—(2) Talk Around. (7) World ey Mouse Club. (9) Dance Show. (9) Dance Party. en ion winers 1:06—WJR, Woolworth Hour WPON, Rise 'n’ Shine WPON, News —WJR, Musi¢ Hall Adventures Shop. (9) Motor City Party. 5:30—(7) Mickey Mouse Club. Ld] WWJ, Weekend Music 9:90—WJIR, William Sheehan | 1@:30—WJR, Tennessee Ernie ww, Jim Deland 5:30—(7) Mickey Mouse Club. (9); (4) Howdy Doody. (9) Howdy Cae: pace oT" We, Beianetiarest | Win toy e'sle Torn | awe peas Ener | Movie eee Dee | A Bemis Deets 19) Heed Cc i a = , , we . WJBK. News, Lenbardt | 2 * News, Toby David | CKLW. Ted McCoy WJBK’ Don McLeod 1:30—(2) Tom Harmon's Work - y For Quality Service at WCAR, News, X-mas Music K! News, Tom George WJBK, Mickey Shorr WPON, Dinner Serenade shop. (7) Black Spider. (4) CKLW. News On TV-Monday, Dec. 26..4 P.M. Cleveland Browns vs. Los Angeles Rems Amateur Singer Wins Singer Willie McClain, of 14 Clo-| - 'vese St., won an appearance on a From all the boys... DICK JOE HARRY CURLY VERNON DON Judges in the local contest were Leonard Buzz, supervisor of rec- reation for the Pontiac Dept. of/5 Parks and Recreation; and Marge R. Belaney of the Chamber of Commerce staff. IC) Slvi@iein TAIT T Michael has Company for Coffee. 1:45—(2) Weekly News Roundup. 2:00—(2) Famous Playhouse. a) Nut Cracker. ahan. 3: ee—i2) Adventure. (4) Dr. Spock. Story. $:00—(2) Omnibus. (7) Super Cir- cus. 5:30—(4) Captain Gallant. (7) Sup- er Circus. (9) Hopalong Cassidy. SUNDAY’S TV HIGHLIGHTS 6:00—(4) Meet the Press. Robert Frost is the special Christmas Day guest. (7) Frontier Justice. “The Dalton Gang.” A shift from the law to the lawless. (9) | H. W. Huttenlocher Agency -- Today's Television Programs --Gobel to Appear in Color and Patronage All Enjoy a and May You HAPPY and ai Fair Prices of These TV , Call Any Service Firms PONTIAC Y CONDON’S RADIO-TV BUSSARD ELECTRIC SHOP.... CAMPBELL RADIO & TV SERV. WEST OF MAC RADIO & TV.. Hemme TV Sh : : | - BIRR @F GPO me @. 4. = = =—=—=— £2 ANDRE CONDONS RADIU-EV.......- 127. S. Parke, FE 4-9736 WORLD GHAMPION PRO. FOOTBALL |TV Show Appearance sire sotees Cheesy at eee Fe sO , 89 Chamberlain, FE 3.7406 - Sr Ad ehalarte ie Sa Datat ilevislon variety protram) Jumbo Teter (9) Sd CUR TY eAtRaCe MEEVICK om Clemens FEI TAL ‘last night after he was named first-| Theater. ; 1A : FE 4-2525 Central Distributing Co. | place winner in a recent talent 8: 30—(4) Zoo Parade. (7) Little HOD'S & aDIO a ty. lake 770 Orchard ar ate. FE caer Distributors of MILLERS HIGH LIFE BEER G ALE lcontest sponsored by Frankenmuth! Rascals. rpg pale Tcereae & TV... 0... . i Li con Breweries. /4:00—(2) Face the Nation. (4) Fi wiecemu seman: - : ial RICH & PURSELY TV............. 2141 Opdyke, FE 4-0221 Known as “Ed McKenzie’s Mu-| No Room at the Inn. (9) Million STEFANSKI RADIO & TV.. .....1157 W. Huron, z sicade,” the program saluted Pon- Rape grain Ray Beun. (8) 3 SWEETS RADIO APPLIANCE. ... 428 'W. Boren, FE 6-1133 tiac as a ‘dynamic neighbor to the| 4 udge an. | i iO &@ TV... .......... — = v» |} WKC, INC, SERVICE DEPT........ 45 N. Perry, FE 2-0711 = oe ee ee ee ee = 2 BOULEVARD RADIO & TV SERVICE. 512 Osmun, FE 4-7723 PONTIAC .-1515 Union Lk. Rd., EM 3-3072 AUBURN BEIGHTS ACE TV & RADIO SERVICE GENE’S TV SALES & SERVICE BIRMIN ELECTRONICS PARK HILL ELECTRONICS, 3357 Auburn Rd., FE 8-1204 3351 Grant, FE 4-8972 GHAM SERVICE CO., 1287 8S. Woodward, MI 6-1622 Leng Lake at Woodward, MI 4-7700 CLARKSTON LAATSCH’S TV SERVICE 6734 Dixie, MA 5-5311 4 STAT ALT 1 1 SACI 14 Gilead Baptist Church. , , P RINi¢ ~ ' SOUTH BLVD. GULF SERVICE CA pRTSIPIreTOTe [6:02 You Are There LAKE ORION : SREHSIETRIATTIET | ington Crosses the Delaware ve BELTON RADIO & TV... ..16 N. Broadway, MY 2-5211 “ , menoes Fo Br isieie scanagel boy id hse ss ation . ° LATIMER’S RADIO ouarr rae habaw R4., OR 3-2652 6) boy disa : R’S 10 & Sashabaw - And Thanks for Yoyr Loyalty PHELPS ELECTRIC ...,..........4348 Dixie Hwy. OR 3-1217 OxFrorD OXFORD RADIO & TV SHOP, 0 8. Washington, OA 8-2032 ROCHESTER j cs ~ MUNTZ TV ‘SERVICE 6 Years’ Eupariinte Servicing Muntz TV Cov FE 41515 993 Me. Clem. PROSPEROUS NEW YEAR. Auburn 5 and 10 1 Block Eost of East Bivd. 640 Auburn Ave. | ROCHESTER RADIO & TV SHOP Main St., OL 2-210 DOBAT TV & RADIO. SERVICE. iey W. Sth St. OL 2-4722 : AVON @ TROY TOWNSHIP FRANK'S TV SERVICE... . 3832 Alida St, FE 4-7566 WALLED LAKE mun 1 mi ftom | at HAMPTON’S $25 W. HURON: 4 | THE PONTIAC PRESS, SATURDAY, DECEMBER 24, 1955 _THIRTY-EIGHT = =" coepunity entignal eRe nea WEST HURON ST. WALLED LAKE PERRY at GLENWOOD KEEGO HARBOR BRANCH BRANCH ’ BRANCH BRANCH ~“ F Ward Richards: James P. Harrington Floyd A. Compton Harold J. Owen (4 fan} Ca 1 & Manaze:) (Assistont Cashier & Manazer) (Assistant Cashier 6 Manager) (Assistant Cashier & Manager) LaDonna Brandon Kathryn LaBair Patricia Daniels Shirley Phelps / { laner Ellis Spitey ScAlledorn Maxine Clarkson June Newcombe Marjorie Billingsley Lylla Ross Marguerite One” Derothy. Oliver teary Carman Edna Wagner Rosa Dyer Roy Pauli Margaret Grubbs Bonnita man iat re Melba Goodman ee hy Marilyn Ferguson Victoria Swan Catherine Long Sebastian sleeps Seale soar fides Sue Howe Rosell Newkirk Hazel Howell Sue Koehl Alice Miller Joseph Long Ann Cook Virginia Sherer Lillian Lusk Wayne Dengate Ruth Watson Rosemary Doris Flanagan Lucille White McAlpine Betty Graves Don Shaver DIRECTORS Irving B. Babcock resident 2 Motors Credit Corporation Louis H. Cole L. H. Cole Oil Company W. Russell Eames Eames and Brown Robert R. Eldred Executive Vice Presien! Communit Nati onal Bank of Pontiac Harold A. Fitzgerald Publisher, The Pontiac Press Alfred C. Girard President and Cheirr an of the Board aC mm nity Yanona "Rant of Pontia Alfred R. Glancy, IF President, A. R. Glancy, Inc Harold E. Howlett Howard W. Huttenlocher H. W. Huttenlocker Agency Harry M. Pryale President, Baldwin Rubber Company From the Directors, Officers and Employees of gor The Community National Bank Roster of Bank Employees Claudette Acha Doris Adkins Inade! Anderson Margaret Andress Janet Baker Beverly Ball Elna Banghart Esther Banghart Barbara Beacom Doris Beattie Mary Beaupre Richard Benham Elena Bennett Betty Berg Madeline Betz Helen Bigford Dorothy Bigsby Flora Bills Helen Blankenship Georgeanna Block Louise Boyl Florence Bradley Gay Brandt Paul Breininger Dorothy Brim Helene Buchanan Marian Bumgardner Dorothy Burch Donna Burlin- Edna Church Jay Clark Donald Cole Rosemary Cole Mozelle Cole William Cole Marion Craft Jack Crawford Helen Cremer Colleen Curran Patricia Dean Helma Diskey Romaine Dreger Florence Ely -Velda Emeigh The ommunit WITH BRANCHES «- PERRY at GLENWOOD . Joyce Farmer Stanley Ford Betty Fran John Gardiner Joyce Gooch Patricia Grubaugh Nancy Hamel Elaine Hamilton Ada Harrison Rosa Heckman Lena Hefner Jean Hegwood Alice Highbaugh Hubert Hill Lura Hillis Mabel Hodge Shelvy Hodges Arlene Hollenback Jean Holt Agnes Horne Arlene Horstman Carolyn Hunt Nancie Ives Ellen Jones JaAnn Jones Mary Ellen Jones Fred Joyce Dale Kage Helen Kight Joan Kiley Robert Kimble, Jr. Diana Kokins Virginia Korthals Georgia Kresge Vivian Kruchko _Clement LaBarge Lila LaClair Betty Latimer » Helen Lawrence Mildred Lawrence Louise Lenz Beverly Leonas Maria Leone Stephanie Linabury Ann Lindle eo WEST HURON at TILDEN . 4 Member of the F — a Iran Suge temgat ’ ’ Fa] Betty Lippard Nancy Lubow Lester Lyons Gloria Maddox Joyce Mapley Ruth Martinez Leone Maslowski Doris Mason Marilyn McArthur Leo McCall Patricia McCarthy Beth McEvoy Nancy McGovern. George McInally Robert McInnis Rachel McKibben Edward McLaughlin Dolores McMurphy * Irene McVay Catherine Meyer Myrtle Miller Estella Mitchell Marjean Monetta Nuella -Moore Ruth Muirhead Kathleen Nelson Robert Norberg Glenda Oldenburg Marion Olmstead Patricia Parker Norma Patterson Laura Pearson Connie Perkins Gail Peters Mary Ann Pickering Verna Preece Joan Pritchett Julia Putte Nancy Reid Agnes Richer June Russako Jeannine Samson Natio al Ann Schneider Jaseph Seddon Isabel Selden Nelson Singleton Margaret Skiba Cillian Slade Pearl Smith Alberta Stark Ina Stelle Dorothy Stoner Hazel Stratton Florence Sutt Donna Sutton Mildred Swaney Dana Taft Louise Tate Dolores Taylor Donald Taylor Nola Taylor Catherine Thompson Joyce Thompson Phyllis Thompson Jane Thornberry Martha Thorne Ann Tierney Edna Trawick Glen Treadway Delores Turnbull Beatrice VanKleek Rose Vartanian Norma Volk Marcella Wallace Sandra Wampfler Jean Warnock Margaret Waters Joyce Watson Gladys West Phyllis Wilcox Jacqueline Wilder Jeannette Wischman June Wortman Gerald Zubolik Vonda Zuehlke wi Sa OFFICERS Alfred C. Girard President and Chairman of the Board Robert R. Eldred Executive Vice President W. Arthur Taylor Vice PreStdent and Cashier John P. Niggeman Carroll L. Osmun Vice Presidents William E. Cashin, Jr. ° Assistant Vice Presiden: Gordon M. McLeod Assistant Cashier and Auditor Dawson C. Baer -Leroy E. Cambrey Charles R. Harris Willard V: Johnsory Edward S. Ladd Horace W. Lodge, Jr. Edgar F. Schulz Robert L. Shueller Harry E. Windiate Assistant Cashiers Harold J. Owen Huron Street Branch James P. Harrington Perry Street Branch F. Ward Richards Walled Lake Branch Floyd A. Compton Keego Harbor Branch (Assistant Cashiers & Managers) ” matin . KEEGO: HARBOR, MICHIGAN. and WALLED ern MICHIGAN